BP914355
Clone id YMU001_000058_A03
Library
Length 152
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000058_A03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACTCTCCCCATGGAGGTCTGACCTGCAGCATATCAACAACCGTGCACCCAAGCGAGCACA
CATCGGACGCACATCCCTGTTCCTCTCCTCTTACAACCTCCGGTGCCATCCAGAGCGGGG
TACCCTTAAATTCATGTGTAGGAGTACATGCT
■■Homology search results ■■ -
sp_hit_id Q61084
Definition sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus
Align length 41
Score (bit) 61.2
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914355|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_A03.
(152 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kin... 61 2e-09
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kin... 61 2e-09
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kin... 57 2e-08
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kin... 57 2e-08
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kin... 54 3e-07
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kin... 51 2e-06
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Sch... 50 3e-06
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kin... 50 4e-06
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=D... 50 4e-06
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopu... 49 6e-06
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopu... 49 6e-06
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinas... 49 8e-06
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kin... 49 8e-06
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kin... 49 8e-06
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio ... 48 1e-05
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolem... 48 1e-05
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus mu... 48 1e-05
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca... 48 1e-05
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur ... 48 1e-05
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo s... 48 1e-05
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobu... 48 1e-05
sp|A4K2Y1|STK4_CERAE Serine/threonine-protein kinase 4 OS=Cercop... 48 1e-05
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos ta... 48 1e-05
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus ... 48 1e-05
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosa... 48 1e-05
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Sch... 48 2e-05
sp|Q56UN5|YSK4_HUMAN SPS1/STE20-related protein kinase YSK4 OS=H... 47 2e-05
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopu... 47 2e-05
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus n... 47 2e-05
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus mu... 47 2e-05

>sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase
3 OS=Mus musculus GN=Map3k3 PE=1 SV=1
Length = 626

Score = 61.2 bits (147), Expect = 2e-09
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +DV SLGCTVV+ML +PPW E
Sbjct: 529 GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE 569


>sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase
3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2
Length = 626

Score = 61.2 bits (147), Expect = 2e-09
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +DV SLGCTVV+ML +PPW E
Sbjct: 529 GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE 569


>sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase
2 OS=Mus musculus GN=Map3k2 PE=1 SV=2
Length = 619

Score = 57.4 bits (137), Expect = 2e-08
Identities = 23/41 (56%), Positives = 30/41 (73%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +D+ S+ CTVV+ML +PPW E
Sbjct: 523 GTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAE 563


>sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase
2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2
Length = 619

Score = 57.4 bits (137), Expect = 2e-08
Identities = 23/41 (56%), Positives = 30/41 (73%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +D+ S+ CTVV+ML +PPW E
Sbjct: 523 GTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAE 563


>sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase
3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1
Length = 651

Score = 53.5 bits (127), Expect = 3e-07
Identities = 21/42 (50%), Positives = 29/42 (69%)
Frame = -2

Query: 127 KGTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
KGTP WMAPEV+ ++D+ S+GCTV++M +PPW E
Sbjct: 234 KGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMATGKPPWSE 275


>sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase
ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2
Length = 666

Score = 50.8 bits (120), Expect = 2e-06
Identities = 20/48 (41%), Positives = 30/48 (62%)
Frame = -2

Query: 145 TPTHEFKGTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
T KGTP WMAPEV+ ++D+ S+GCTV++M+ + PW +
Sbjct: 229 TGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQ 276


>sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1
OS=Schizosaccharomyces pombe GN=sid1 PE=1 SV=1
Length = 471

Score = 50.4 bits (119), Expect = 3e-06
Identities = 22/47 (46%), Positives = 29/47 (61%)
Frame = -2

Query: 151 ACTPTHEFKGTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPP 11
A + H F GTP WMAPEV++ G A+D+ SLG T ++M PP
Sbjct: 158 AASRRHTFVGTPFWMAPEVIQQTSYGLAADIWSLGITAIEMANGIPP 204


>sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase
2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1
Length = 651

Score = 50.1 bits (118), Expect = 4e-06
Identities = 19/42 (45%), Positives = 29/42 (69%)
Frame = -2

Query: 127 KGTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
KGTP WMAPEV+ ++D+ S+GCTV++M+ + PW +
Sbjct: 234 KGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQ 275


>sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo
OS=Drosophila melanogaster GN=hpo PE=1 SV=1
Length = 669

Score = 50.1 bits (118), Expect = 4e-06
Identities = 20/41 (48%), Positives = 28/41 (68%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WMAPEV+ C +D+ SLG T ++M + +PP+GE
Sbjct: 198 GTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGE 238


>sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus
tropicalis GN=stk4 PE=2 SV=1
Length = 485

Score = 49.3 bits (116), Expect = 6e-06
Identities = 19/41 (46%), Positives = 28/41 (68%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WMAPEV++ C +D+ SLG T ++M + +PP+ E
Sbjct: 186 GTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYAE 226


tr_hit_id A0CGL2
Definition tr|A0CGL2|A0CGL2_PARTE Chromosome undetermined scaffold_18, whole genome shotgun sequence OS=Paramecium tetraurelia
Align length 44
Score (bit) 65.5
E-value 1.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914355|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_A03.
(152 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A0CGL2|A0CGL2_PARTE Chromosome undetermined scaffold_18, whol... 65 1e-09
tr|A9TPK3|A9TPK3_PHYPA Predicted protein (Fragment) OS=Physcomit... 65 2e-09
tr|A9RMC0|A9RMC0_PHYPA Predicted protein (Fragment) OS=Physcomit... 64 3e-09
tr|A9S2K2|A9S2K2_PHYPA Predicted protein (Fragment) OS=Physcomit... 63 8e-09
tr|A0DBL2|A0DBL2_PARTE Chromosome undetermined scaffold_44, whol... 63 8e-09
tr|A0DAQ9|A0DAQ9_PARTE Chromosome undetermined scaffold_43, whol... 63 8e-09
tr|Q4RWK0|Q4RWK0_TETNG Chromosome 3 SCAF14987, whole genome shot... 61 2e-08
tr|Q3UVM5|Q3UVM5_MOUSE Putative uncharacterized protein OS=Mus m... 61 2e-08
tr|B5DF98|B5DF98_RAT Map3k3 protein (Mitogen activated protein k... 61 2e-08
tr|B1AR87|B1AR87_MOUSE Mitogen activated protein kinase kinase k... 61 2e-08
tr|A7P0M3|A7P0M3_VITVI Chromosome chr19 scaffold_4, whole genome... 61 2e-08
tr|A5C036|A5C036_VITVI Putative uncharacterized protein OS=Vitis... 61 2e-08
tr|A7S4G7|A7S4G7_NEMVE Predicted protein (Fragment) OS=Nematoste... 61 2e-08
tr|Q96HN9|Q96HN9_HUMAN Putative uncharacterized protein (Fragmen... 61 2e-08
tr|Q7Z4E6|Q7Z4E6_HUMAN MSTP094 OS=Homo sapiens GN=MST094 PE=2 SV=1 61 2e-08
tr|Q1PBM3|Q1PBM3_HUMAN Mitogen-activated protein kinase kinase k... 61 2e-08
tr|Q4TCX7|Q4TCX7_TETNG Chromosome undetermined SCAF6648, whole g... 61 3e-08
tr|Q4RMW8|Q4RMW8_TETNG Chromosome 3 SCAF15018, whole genome shot... 61 3e-08
tr|O64741|O64741_ARATH Putative uncharacterized protein At2g3004... 61 3e-08
tr|A9SP75|A9SP75_PHYPA Predicted protein (Fragment) OS=Physcomit... 61 3e-08
tr|A9RP64|A9RP64_PHYPA Predicted protein (Fragment) OS=Physcomit... 61 3e-08
tr|Q8L594|Q8L594_ORYSJ Putative NPK1-related protein kinase (Put... 60 4e-08
tr|A7QC95|A7QC95_VITVI Chromosome undetermined scaffold_77, whol... 60 4e-08
tr|A2Z4S3|A2Z4S3_ORYSI Putative uncharacterized protein OS=Oryza... 60 4e-08
tr|Q8RY70|Q8RY70_MAIZE NPK1-related protein kinase-like protein ... 60 5e-08
tr|Q389U2|Q389U2_9TRYP Protein kinase, putative OS=Trypanosoma b... 60 5e-08
tr|A0DD07|A0DD07_PARTE Chromosome undetermined scaffold_46, whol... 60 5e-08
tr|Q8L3T2|Q8L3T2_ORYSJ Putative NPK1-related protein kinase (Pro... 60 7e-08
tr|Q0JK37|Q0JK37_ORYSJ Os01g0699100 protein (Fragment) OS=Oryza ... 60 7e-08
tr|B8QUI8|B8QUI8_ORYSI NPKL1 OS=Oryza sativa subsp. indica PE=4 ... 60 7e-08

>tr|A0CGL2|A0CGL2_PARTE Chromosome undetermined scaffold_18, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00007369001 PE=4 SV=1
Length = 374

Score = 65.5 bits (158), Expect = 1e-09
Identities = 26/44 (59%), Positives = 34/44 (77%)
Frame = -2

Query: 136 HEFKGTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWG 5
+ KGTP WMAPEV+ G+E G SD+ SLGCT+++ML +PPWG
Sbjct: 215 YSLKGTPNWMAPEVINGQETGRYSDIWSLGCTIIEMLTGQPPWG 258


>tr|A9TPK3|A9TPK3_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_4890 PE=4 SV=1
Length = 268

Score = 64.7 bits (156), Expect = 2e-09
Identities = 28/41 (68%), Positives = 33/41 (80%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTPLWMAPEVVR +EQG ASD+ SLGCTVV+M + PW +
Sbjct: 170 GTPLWMAPEVVRQDEQGLASDIWSLGCTVVEMATGKAPWSD 210


>tr|A9RMC0|A9RMC0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_176382 PE=4 SV=1
Length = 276

Score = 64.3 bits (155), Expect = 3e-09
Identities = 29/40 (72%), Positives = 32/40 (80%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWG 5
GTPLWMAPEVVR EQG ASD+ SLGCTVV++ R PWG
Sbjct: 180 GTPLWMAPEVVRQVEQGPASDIWSLGCTVVELASGRAPWG 219


>tr|A9S2K2|A9S2K2_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_16331 PE=4 SV=1
Length = 277

Score = 62.8 bits (151), Expect = 8e-09
Identities = 27/39 (69%), Positives = 32/39 (82%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPW 8
GTPLWMAPEVVR +EQG ASD+ SLGCTV++M + PW
Sbjct: 181 GTPLWMAPEVVRQDEQGLASDIWSLGCTVLEMATGKAPW 219


>tr|A0DBL2|A0DBL2_PARTE Chromosome undetermined scaffold_44, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00015325001 PE=4 SV=1
Length = 382

Score = 62.8 bits (151), Expect = 8e-09
Identities = 25/44 (56%), Positives = 32/44 (72%)
Frame = -2

Query: 136 HEFKGTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWG 5
+ KGTP WMAPEV+ +E G SD+ SLGCT+++ML PPWG
Sbjct: 215 YSLKGTPNWMAPEVINSQETGRYSDIWSLGCTIIEMLTGEPPWG 258


>tr|A0DAQ9|A0DAQ9_PARTE Chromosome undetermined scaffold_43, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00015033001 PE=4 SV=1
Length = 381

Score = 62.8 bits (151), Expect = 8e-09
Identities = 25/45 (55%), Positives = 33/45 (73%)
Frame = -2

Query: 136 HEFKGTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
+ KGTP WMAPEV+ +E G SD+ SLGCT+++ML PPWG+
Sbjct: 215 YSLKGTPNWMAPEVINQQETGRYSDIWSLGCTIIEMLTSEPPWGK 259


>tr|Q4RWK0|Q4RWK0_TETNG Chromosome 3 SCAF14987, whole genome shotgun
sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00027814001 PE=4 SV=1
Length = 615

Score = 61.2 bits (147), Expect = 2e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +DV SLGCTVV+ML +PPW E
Sbjct: 520 GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTQKPPWAE 560


>tr|Q3UVM5|Q3UVM5_MOUSE Putative uncharacterized protein OS=Mus
musculus GN=Map3k3 PE=2 SV=1
Length = 626

Score = 61.2 bits (147), Expect = 2e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +DV SLGCTVV+ML +PPW E
Sbjct: 529 GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE 569


>tr|B5DF98|B5DF98_RAT Map3k3 protein (Mitogen activated protein
kinase kinase kinase 3) (Predicted) OS=Rattus norvegicus
GN=Map3k3 PE=2 SV=1
Length = 626

Score = 61.2 bits (147), Expect = 2e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +DV SLGCTVV+ML +PPW E
Sbjct: 529 GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE 569


>tr|B1AR87|B1AR87_MOUSE Mitogen activated protein kinase kinase
kinase 3 OS=Mus musculus GN=Map3k3 PE=4 SV=1
Length = 626

Score = 61.2 bits (147), Expect = 2e-08
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -2

Query: 124 GTPLWMAPEVVRGEEQGCASDVCSLGCTVVDMLQVRPPWGE 2
GTP WM+PEV+ GE G +DV SLGCTVV+ML +PPW E
Sbjct: 529 GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE 569