BP914358
Clone id YMU001_000058_A06
Library
Length 563
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000058_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCTCAGAGGGGGGCCATCACAAAGATAGACGATACAAAGGAGGATATGGAGGAGATTGTC
ACTATACTATAGAGGCCCATGAGACAGTTCATTAGATGATCTCCTCCCATCTCAGGCTTA
CTTCTTATTTCAATCAATGCGGTCTTACCTACCCACCCACCACGAGCGATATTGTATCTA
GTTTCATTTCAGTACTTAGTTTCTGTCACAGATAGTTGTATCACTCAGATGGTAGTTGTA
TATTATGATCCCGTAGATCATTTTGGCCTTTTGCAGACGTTAACAATACATTTCATTTCT
CACACATACGCTCGCACGCACACACATTTTTCTTTGAAAAAAATAGCCTCCTGCAACCAC
CTCTAGAAATGAAATCAACAAGCCAACAAACAATTGAGTTTAAGTTGTACATTCATGCGG
ACCATCCTGGTAAAAAGTACAAACCAAAAACAAAAATAAAGAATAGCATATTACCAATTT
GTATGACTGTAGTTGCGCAGGTAGTTGGTACCGCTTTTCTTCAGCACTTGCAGAAATCAA
CAATGGAAAACACAGTTTGATGA
■■Homology search results ■■ -
sp_hit_id Q0DWT8
Definition sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza sativa subsp. japonica
Align length 30
Score (bit) 32.0
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914358|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_A06.
(563 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Ory... 32 2.2
sp|Q9Y679|AUP1_HUMAN Ancient ubiquitous protein 1 OS=Homo sapien... 30 6.3

>sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza
sativa subsp. japonica GN=Os02g0795900 PE=2 SV=1
Length = 521

Score = 32.0 bits (71), Expect = 2.2
Identities = 15/30 (50%), Positives = 24/30 (80%)
Frame = -3

Query: 561 IKLCFPLLISASAEEKRYQLPAQLQSYKLV 472
++L PLL+++ +KRY++P +LQSYKLV
Sbjct: 294 LELQHPLLLNSG--KKRYRIPTKLQSYKLV 321


>sp|Q9Y679|AUP1_HUMAN Ancient ubiquitous protein 1 OS=Homo sapiens
GN=AUP1 PE=1 SV=1
Length = 476

Score = 30.4 bits (67), Expect = 6.3
Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 5/58 (8%)
Frame = -2

Query: 463 FFIFVFGLYFL-----PGWSA*MYNLNSIVCWLVDFISRGGCRRLFFSKKNVCACERM 305
FF F+F FL PG + + S VCW F+ G L S K CA R+
Sbjct: 160 FFFFIFLNIFLLAFSSPGSQPLLNSPPSFVCWSRGFMEMNGRGELVESLKRFCASTRL 217


tr_hit_id A9T7C5
Definition tr|A9T7C5|A9T7C5_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 30
Score (bit) 36.2
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914358|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_A06.
(563 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T7C5|A9T7C5_PHYPA Predicted protein OS=Physcomitrella paten... 36 1.3
tr|B8FBR2|B8FBR2_9DELT Radical SAM domain protein OS=Desulfatiba... 34 6.3
tr|B3LWT5|B3LWT5_DROAN GF16887 OS=Drosophila ananassae GN=GF1688... 33 8.2

>tr|A9T7C5|A9T7C5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_141399 PE=4 SV=1
Length = 462

Score = 36.2 bits (82), Expect = 1.3
Identities = 15/30 (50%), Positives = 23/30 (76%)
Frame = -3

Query: 561 IKLCFPLLISASAEEKRYQLPAQLQSYKLV 472
+ L +PL ++ SAEE RY LP QL+++KL+
Sbjct: 295 LDLYWPLYLAPSAEESRYHLPKQLKAFKLI 324


>tr|B8FBR2|B8FBR2_9DELT Radical SAM domain protein
OS=Desulfatibacillum alkenivorans AK-01 GN=Dalk_3125
PE=4 SV=1
Length = 547

Score = 33.9 bits (76), Expect = 6.3
Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 2/42 (4%)
Frame = +1

Query: 31 DTKEDMEEIVTIL*RPMRQFIR*SPPIS--GLLLISINAVLP 150
+TKED+EEIV + R +F++ S PI G + IS+N+ +P
Sbjct: 385 ETKEDVEEIVALTKRIKHRFLKASQPIGRIGTIHISLNSFVP 426


>tr|B3LWT5|B3LWT5_DROAN GF16887 OS=Drosophila ananassae GN=GF16887
PE=4 SV=1
Length = 410

Score = 33.5 bits (75), Expect = 8.2
Identities = 16/28 (57%), Positives = 17/28 (60%)
Frame = -3

Query: 99 SSNELSHGPL*YSDNLLHILLCIVYLCD 16
SSN LSHG YS N+L LL LCD
Sbjct: 76 SSNNLSHGSCNYSSNMLQFLLLFGVLCD 103