BP914378
Clone id YMU001_000058_C03
Library
Length 638
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000058_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACAACACCAAAAAAAATATCCATCATCTCATTCCTCCCCCACTACATCTAAGCACCAGCT
ATGGAGGCTTTGCTTCAATGCCAACACATCATCGTGTATGAACCATGTCTTCTTCACCTT
GGCAGTGTATGACAACAGCTCAACAGCTCCGTAGCCACATACAAGAACCTTAAGTGGACC
TTACTCCCATGCCACGGTAGTAATGCTGCCATTATTAAGCGAGCAAGTAGCCCCTCAATA
AGTATGACCAGCGGCAAGCCTTCAAAGCCCTTTGTGCAGTTTCTTAAAGCTCTAATAAAC
TGGTTCTTGCTCCGGATGTGCATGGAGTCCAATAGATCGGTGAAGCTGAATATTGTGGTT
TGTCTGATATGCACAAAGTCTAGAAGTAGACAACCCATGACGGCGGCACAACAAAACCAA
GCTCTGATGCTTGTGGGTGCGGCCAAGTATGTCGAAGACCAATGCCCCGCCCATTTATTA
GAGGCAGTAGACAAACACCACAACACAGTGCTCCATGAAGTGAATAGGACATCAAACTGA
AGTACATGAGGTGGGCAGCTTAAGGAAATTCATAAAACATCCCTCTCTGAAAAGAGCTTC
ACATGTACTTGAACCAGATTTTGACACAATTACTTTCT
■■Homology search results ■■ -
sp_hit_id Q6GV28
Definition sp|Q6GV28|P22CD_HUMAN Transmembrane protein PMP22CD OS=Homo sapiens
Align length 102
Score (bit) 32.3
E-value 2.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914378|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_C03.
(638 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6GV28|P22CD_HUMAN Transmembrane protein PMP22CD OS=Homo sapi... 32 2.1
sp|O07402|YE86_MYCAV Uncharacterized protein MAV321 OS=Mycobacte... 30 8.1
sp|Q3AC76|RNH2_CARHZ Ribonuclease HII OS=Carboxydothermus hydrog... 30 8.1

>sp|Q6GV28|P22CD_HUMAN Transmembrane protein PMP22CD OS=Homo sapiens
GN=PMP22CD PE=2 SV=1
Length = 225

Score = 32.3 bits (72), Expect = 2.1
Identities = 24/102 (23%), Positives = 43/102 (42%), Gaps = 6/102 (5%)
Frame = -1

Query: 533 DVLFTSWSTVLWCLSTASNKWAGHWSSTYLAAPTSIRAWFCCAAVMGCLLLDFVHIRQTT 354
++LF+SW+ VL + +KW S A CC A+ L V I T+
Sbjct: 13 NILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPEDDLKVVRIMMTS 72

Query: 353 IFSFTDLLDSM------HIRSKNQFIRALRNCTKGFEGLPLV 246
+ LL+ + ++ +N++I+ F G+ L+
Sbjct: 73 SLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLL 114


>sp|O07402|YE86_MYCAV Uncharacterized protein MAV321
OS=Mycobacterium avium PE=4 SV=2
Length = 306

Score = 30.4 bits (67), Expect = 8.1
Identities = 11/27 (40%), Positives = 17/27 (62%)
Frame = -1

Query: 503 LWCLSTASNKWAGHWSSTYLAAPTSIR 423
+WC S + + WA W + +APTS+R
Sbjct: 1 MWCPSVSLSLWANAWLAGKASAPTSLR 27


>sp|Q3AC76|RNH2_CARHZ Ribonuclease HII OS=Carboxydothermus
hydrogenoformans (strain Z-2901 / DSM 6008) GN=rnhB PE=3
SV=1
Length = 231

Score = 30.4 bits (67), Expect = 8.1
Identities = 19/49 (38%), Positives = 29/49 (59%)
Frame = -1

Query: 404 AVMGCLLLDFVHIRQTTIFSFTDLLDSMHIRSKNQFIRALRNCTKGFEG 258
AV+G L+D ++I Q T F+F LDS+ I+ + + AL+ GF G
Sbjct: 99 AVVGPDLIDRLNIYQATKFAFKAALDSLSIKPEALILDALK--LTGFSG 145


tr_hit_id A6W6J6
Definition tr|A6W6J6|A6W6J6_KINRD Putative PAS/PAC sensor protein OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Align length 49
Score (bit) 36.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914378|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_C03.
(638 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6W6J6|A6W6J6_KINRD Putative PAS/PAC sensor protein OS=Kineoc... 36 1.7
tr|B4L8D1|B4L8D1_DROMO GI10935 OS=Drosophila mojavensis GN=GI109... 35 3.8

>tr|A6W6J6|A6W6J6_KINRD Putative PAS/PAC sensor protein OS=Kineococcus
radiotolerans (strain ATCC BAA-149 / DSM 14245 /
SRS30216) GN=Krad_0947 PE=4 SV=1
Length = 956

Score = 36.2 bits (82), Expect = 1.7
Identities = 18/49 (36%), Positives = 27/49 (55%)
Frame = -1

Query: 359 TTIFSFTDLLDSMHIRSKNQFIRALRNCTKGFEGLPLVILIEGLLARLI 213
+T+ FTD L R + + L+ C G GL L L++G+LARL+
Sbjct: 868 STVLMFTDGLVERRDRGLEEGLEELQECVAGLAGLTLDELVDGVLARLV 916


>tr|B4L8D1|B4L8D1_DROMO GI10935 OS=Drosophila mojavensis GN=GI10935
PE=4 SV=1
Length = 397

Score = 35.0 bits (79), Expect = 3.8
Identities = 13/39 (33%), Positives = 19/39 (48%)
Frame = -1

Query: 506 VLWCLSTASNKWAGHWSSTYLAAPTSIRAWFCCAAVMGC 390
+LW L+ + W W + Y+ PT I+ W CA C
Sbjct: 237 ILWRLTNVNIGWLLLWQTVYVVLPTIIKIWTLCAVCDSC 275