BP914387
Clone id YMU001_000058_C12
Library
Length 533
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000058_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTTTTAAGGCCATTGGATGAAGCTTGTGGATTAGTGCCACATGGCAAG
TTAATGATGGCAAACTCTTTTTCTTTACAATTCCCACAAGAGAGGCATTAACTAAGCATT
GGCTTTTGAATATATAGACCACCTTGAGAAATATTCAGCATTTGCTTTCCTGTTTCTATA
AAAAGGGAGTGGCTCACACACTCTTTCTCATCCTAATATGTAGGCCATTGTCATTTTTCA
CCTTGTTATTCTTGGACTACCAAGCTTCCACATGATACCTGCCAACTCTTTCAAGATGCT
TCAACCATTTTCTTGCAGCATCTTCAGACTGGCAGCCTTCTTTCATGACAACTTTCTCAA
GAGCGGCAAACACATCTGCTGGCATCTTAACCGCAGACCCAGCCACATACACGGCACAAC
CAGACTGTAGCATTGCCCACACCTTTGCAGAGTACTCCTCAATCTTATGTTGCACATACA
CCTTTCTCGGCTGGTCTCTTGAGAACGCTGCAAAGAAGCCACCTCCTTTGGTC
■■Homology search results ■■ -
sp_hit_id Q5E841
Definition sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio fischeri (strain ATCC 700601 / ES114)
Align length 83
Score (bit) 73.9
E-value 4.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914387|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_C12.
(516 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alph... 74 4e-13
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 ... 72 1e-12
sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein alph... 72 2e-12
sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein alph... 72 2e-12
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 ... 70 8e-12
sp|Q05001|NCPR_CATRO NADPH--cytochrome P450 reductase OS=Cathara... 70 8e-12
sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein alph... 69 2e-11
sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein alph... 67 4e-11
sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|A0KTH4|CYSJ_SHESA Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|Q8EAZ9|CYSJ_SHEON Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|A1KU06|CYSJ_NEIMF Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|Q9JS45|CYSJ_NEIMB Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|Q9JUD8|CYSJ_NEIMA Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|A9LZ73|CYSJ_NEIM0 Sulfite reductase [NADPH] flavoprotein alph... 67 5e-11
sp|Q6NRG5|NDOR1_XENLA NADPH-dependent diflavin oxidoreductase 1 ... 67 6e-11
sp|Q0HYB4|CYSJ_SHESR Sulfite reductase [NADPH] flavoprotein alph... 67 6e-11
sp|Q0HFL6|CYSJ_SHESM Sulfite reductase [NADPH] flavoprotein alph... 67 6e-11
sp|Q7MHA5|CYSJ_VIBVY Sulfite reductase [NADPH] flavoprotein alph... 66 1e-10
sp|A5F3I4|CYSJ_VIBC3 Sulfite reductase [NADPH] flavoprotein alph... 66 1e-10
sp|A2AI05|NDOR1_MOUSE NADPH-dependent diflavin oxidoreductase 1 ... 65 1e-10
sp|P37201|NCPR_CANTR NADPH--cytochrome P450 reductase OS=Candida... 65 2e-10
sp|A7MJ63|CYSJ_ENTS8 Sulfite reductase [NADPH] flavoprotein alph... 64 4e-10
sp|Q57KH7|CYSJ_SALCH Sulfite reductase [NADPH] flavoprotein alph... 64 5e-10
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alph... 63 9e-10
sp|Q66ED4|CYSJ_YERPS Sulfite reductase [NADPH] flavoprotein alph... 63 9e-10
sp|A4TPY5|CYSJ_YERPP Sulfite reductase [NADPH] flavoprotein alph... 63 9e-10
sp|Q1CLS8|CYSJ_YERPN Sulfite reductase [NADPH] flavoprotein alph... 63 9e-10
sp|Q8ZBN6|CYSJ_YERPE Sulfite reductase [NADPH] flavoprotein alph... 63 9e-10

>sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein
alpha-component OS=Vibrio fischeri (strain ATCC 700601 /
ES114) GN=cysJ PE=3 SV=1
Length = 604

Score = 73.9 bits (180), Expect = 4e-13
Identities = 36/83 (43%), Positives = 52/83 (62%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
AFSRDQ KVYVQH+I E++A+VW LQ G +YV G A +M DV AL VV + G +
Sbjct: 522 AFSRDQQEKVYVQHRILEHAAQVWQWLQDGAYIYVCGDATRMAKDVHEALICVVEQHGQK 581

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
+ + A +++ L + RY + +
Sbjct: 582 TREEAEQFVNELRKAKRYQRDVY 604


>sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1
OS=Danio rerio GN=ndor1 PE=2 SV=1
Length = 595

Score = 72.4 bits (176), Expect = 1e-12
Identities = 36/84 (42%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAML-QSGCAVYVAGSAVKMPADVFAALEKVVMKEGC 315
AFSRDQ KVYVQH+++E +W ++ + Y+AG+A +MP V AL+ V KEG
Sbjct: 511 AFSRDQEDKVYVQHRVKEQGKLLWDLIAKKNAFFYIAGNAKQMPTSVCDALKAVFQKEGG 570

Query: 314 QSEDAARKWLKHLERVGRYHVEAW 243
SE+ A++ L +E+ GR+ E W
Sbjct: 571 MSENQAQEMLDGMEKNGRFQSETW 594


>sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein
alpha-component OS=Photobacterium profundum GN=cysJ PE=3
SV=1
Length = 605

Score = 72.0 bits (175), Expect = 2e-12
Identities = 36/83 (43%), Positives = 50/83 (60%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
AFSRDQ KVYVQH++ E++ +VW LQ G VYV G M DV AL V+ ++G Q
Sbjct: 523 AFSRDQVEKVYVQHRVLEHAEQVWQWLQEGAHVYVCGDMNHMAKDVHDALLTVIEQQGKQ 582

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
S + A ++L L + RY + +
Sbjct: 583 SREQAEQYLNELRKSKRYQKDVY 605


>sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein
alpha-component OS=Vibrio parahaemolyticus GN=cysJ PE=3
SV=1
Length = 623

Score = 71.6 bits (174), Expect = 2e-12
Identities = 36/83 (43%), Positives = 49/83 (59%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
AFSRDQ KVYVQH+I E +A+VW +Q G +YV G A +M DV AL V +EG
Sbjct: 541 AFSRDQVEKVYVQHRILENAAQVWQWIQDGAYIYVCGDATRMAKDVHDALVIVAEQEGKM 600

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
D A +++ L + RY + +
Sbjct: 601 PRDDAEQFINDLRKAKRYQRDVY 623


>sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1
OS=Homo sapiens GN=NDOR1 PE=1 SV=1
Length = 597

Score = 69.7 bits (169), Expect = 8e-12
Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAML-QSGCAVYVAGSAVKMPADVFAALEKVVMKEGC 315
AFSR+Q +KVYVQH++ E + VW +L + G Y+AG+A MPADV AL + +EG
Sbjct: 513 AFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGG 572

Query: 314 QSEDAARKWLKHLERVGRYHVEAW 243
A +L L++ R+ E W
Sbjct: 573 LCSPDAAAYLARLQQTRRFQTETW 596


>sp|Q05001|NCPR_CATRO NADPH--cytochrome P450 reductase
OS=Catharanthus roseus GN=CPR PE=2 SV=1
Length = 714

Score = 69.7 bits (169), Expect = 8e-12
Identities = 32/83 (38%), Positives = 46/83 (55%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
AFSR+ P K YVQHK+ E ++ +W M+ G VYV G A M DV L + ++G
Sbjct: 632 AFSREGPTKQYVQHKMAEKASDIWRMISDGAYVYVCGDAKGMARDVHRTLHTIAQEQGSM 691

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
A ++K+L+ GRY + W
Sbjct: 692 DSTQAEGFVKNLQMTGRYLRDVW 714


>sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein
alpha-component OS=Vibrio vulnificus GN=cysJ PE=3 SV=1
Length = 616

Score = 68.6 bits (166), Expect = 2e-11
Identities = 35/83 (42%), Positives = 48/83 (57%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
AFSRDQ KVYVQ +I E +A+VW +Q G +YV G A +M DV A V +EG
Sbjct: 534 AFSRDQAEKVYVQQRILENAAQVWQWIQEGAYLYVCGDANRMAKDVHQAFVAVAEQEGKM 593

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
S D A +++ L + RY + +
Sbjct: 594 SRDDAEEFINDLRKAKRYQRDVY 616


>sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein
alpha-component OS=Mannheimia succiniciproducens (strain
MBEL55E) GN=cysJ PE=3 SV=1
Length = 597

Score = 67.4 bits (163), Expect = 4e-11
Identities = 36/83 (43%), Positives = 48/83 (57%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
A+SRDQ K+YVQ KI E S +W LQ G VYV G A KM DV AL +V+ +EG
Sbjct: 515 AWSRDQAEKIYVQDKIREKSTALWQWLQEGAHVYVCGDASKMAKDVENALLEVIAREGKL 574

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
+ + A ++L L RY + +
Sbjct: 575 TPEDAEEYLNDLREDKRYQRDVY 597


>sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein
alpha-component OS=Vibrio cholerae GN=cysJ PE=3 SV=1
Length = 614

Score = 67.0 bits (162), Expect = 5e-11
Identities = 34/83 (40%), Positives = 48/83 (57%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
AFSRDQ KVYVQH++ E + VW LQ G YV G A +M DV AL VV ++G
Sbjct: 532 AFSRDQHEKVYVQHRLLEQAELVWQWLQEGAYFYVCGDASRMAKDVHQALITVVEQQGGL 591

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
+ + A +++ L + RY + +
Sbjct: 592 NREQAEEYVSELRKAKRYQRDVY 614


>sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein
alpha-component OS=Sodalis glossinidius (strain
morsitans) GN=cysJ PE=3 SV=1
Length = 603

Score = 67.0 bits (162), Expect = 5e-11
Identities = 33/83 (39%), Positives = 47/83 (56%)
Frame = -2

Query: 491 AFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVVMKEGCQ 312
A+SRDQ K+YVQ ++ E A+VW +Q G +YV G A +M DV AL VV + GC
Sbjct: 521 AWSRDQAEKIYVQDRVREQGAEVWRWIQQGAHIYVCGDANRMARDVEQALVAVVAEYGCM 580

Query: 311 SEDAARKWLKHLERVGRYHVEAW 243
+ A ++L L RY + +
Sbjct: 581 DPEQADEYLSELRIERRYQRDVY 603


tr_hit_id Q1KUY9
Definition tr|Q1KUY9|Q1KUY9_9ROSI Putative uncharacterized protein OS=Cleome spinosa
Align length 91
Score (bit) 124.0
E-value 4.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914387|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_C12.
(516 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q1KUY9|Q1KUY9_9ROSI Putative uncharacterized protein OS=Cleom... 124 4e-27
tr|Q5JL61|Q5JL61_ORYSJ cDNA clone:J013088B01, full insert sequen... 122 1e-26
tr|B8A920|B8A920_ORYSI Putative uncharacterized protein OS=Oryza... 122 1e-26
tr|A2ZXJ4|A2ZXJ4_ORYSJ Putative uncharacterized protein OS=Oryza... 122 1e-26
tr|Q9SRU4|Q9SRU4_ARATH Putative NADPH-ferrihemoprotein reductase... 119 7e-26
tr|Q6NPS8|Q6NPS8_ARATH At3g02280 (Putative uncharacterized prote... 119 7e-26
tr|B4FCZ6|B4FCZ6_MAIZE Putative uncharacterized protein OS=Zea m... 119 7e-26
tr|A7PAP2|A7PAP2_VITVI Chromosome chr14 scaffold_9, whole genome... 119 9e-26
tr|B6T7V0|B6T7V0_MAIZE NADPH reductase TAH18 OS=Zea mays PE=2 SV=1 117 3e-25
tr|A2Q1Q9|A2Q1Q9_MEDTR Flavoprotein pyridine nucleotide cytochro... 117 3e-25
tr|A9SKW3|A9SKW3_PHYPA Predicted protein OS=Physcomitrella paten... 108 1e-22
tr|A4RR54|A4RR54_OSTLU Predicted protein OS=Ostreococcus lucimar... 83 7e-15
tr|Q4Q8E2|Q4Q8E2_LEIMA P450 reductase, putative OS=Leishmania ma... 83 7e-15
tr|Q71BB3|Q71BB3_BRAFL NADPH-dependent FMN and FAD containing ox... 82 2e-14
tr|A4I3K3|A4I3K3_LEIIN p450 reductase, putative OS=Leishmania in... 82 2e-14
tr|Q1IDH0|Q1IDH0_PSEE4 Assimilatory nitrate reductase OS=Pseudom... 79 1e-13
tr|Q1B6Z8|Q1B6Z8_MYCSS Sulfite reductase (NADPH) alpha subunit O... 78 3e-13
tr|A3Q1J1|A3Q1J1_MYCSJ Sulfite reductase (NADPH) alpha subunit O... 78 3e-13
tr|A1UI27|A1UI27_MYCSK Sulfite reductase (NADPH) alpha subunit O... 78 3e-13
tr|B6MET5|B6MET5_BRAFL Putative uncharacterized protein OS=Branc... 77 7e-13
tr|Q4SRM0|Q4SRM0_TETNG Chromosome undetermined SCAF14518, whole ... 76 1e-12
tr|B5FX83|B5FX83_TAEGU Putative NADPH dependent diflavin oxidore... 75 2e-12
tr|Q15NK0|Q15NK0_PSEA6 Sulfite reductase (NADPH) alpha subunit O... 75 2e-12
tr|B7Q688|B7Q688_IXOSC Cytochrome P450, putative OS=Ixodes scapu... 75 2e-12
tr|A4HGH1|A4HGH1_LEIBR p450 reductase, putative OS=Leishmania br... 75 2e-12
tr|B6ELM4|B6ELM4_ALISL Sulfite reductase [NADPH] flavoprotein al... 74 4e-12
tr|Q9P4E1|Q9P4E1_9FUNG NADPH-dependent cytochrome P450 oxidoredu... 74 4e-12
tr|Q00UN4|Q00UN4_OSTTA Putative NADPH-de (ISS) OS=Ostreococcus t... 74 6e-12
tr|B6PMY3|B6PMY3_BRAFL Putative uncharacterized protein OS=Branc... 74 6e-12
tr|B6PAX9|B6PAX9_BRAFL Putative uncharacterized protein OS=Branc... 74 6e-12

>tr|Q1KUY9|Q1KUY9_9ROSI Putative uncharacterized protein OS=Cleome
spinosa PE=4 SV=1
Length = 630

Score = 124 bits (310), Expect = 4e-27
Identities = 60/91 (65%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
Frame = -2

Query: 512 KGGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSG-CAVYVAGSAVKMPADVFAALEK 336
KGGGF+AAFSRDQP+KVYVQHKI E KVW +L+ G AVYVAGS+ KMPADV AALE+
Sbjct: 539 KGGGFYAAFSRDQPKKVYVQHKIREQRKKVWELLRDGGAAVYVAGSSTKMPADVMAALEE 598

Query: 335 VVMKEGCQSEDAARKWLKHLERVGRYHVEAW 243
+V +E S+ A +WL+ LE+ GRYHVEAW
Sbjct: 599 IVAEETGGSKADAERWLRALEKAGRYHVEAW 629


>tr|Q5JL61|Q5JL61_ORYSJ cDNA clone:J013088B01, full insert sequence
OS=Oryza sativa subsp. japonica GN=B1060H01.9 PE=2 SV=1
Length = 626

Score = 122 bits (306), Expect = 1e-26
Identities = 56/89 (62%), Positives = 71/89 (79%)
Frame = -2

Query: 509 GGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVV 330
GGGFF AFSRDQP+KVYVQH+I E SA+VW +L+SG A+Y+AGS+ KMPADV AALE+V+
Sbjct: 537 GGGFFVAFSRDQPQKVYVQHRIREQSARVWNLLKSGAAIYIAGSSTKMPADVTAALEEVI 596

Query: 329 MKEGCQSEDAARKWLKHLERVGRYHVEAW 243
+E SE+ A WL+ LER G++H E W
Sbjct: 597 CQETGCSEEEASIWLRKLERNGKFHTETW 625


>tr|B8A920|B8A920_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03638 PE=4 SV=1
Length = 626

Score = 122 bits (306), Expect = 1e-26
Identities = 56/89 (62%), Positives = 71/89 (79%)
Frame = -2

Query: 509 GGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVV 330
GGGFF AFSRDQP+KVYVQH+I E SA+VW +L+SG A+Y+AGS+ KMPADV AALE+V+
Sbjct: 537 GGGFFVAFSRDQPQKVYVQHRIREQSARVWNLLKSGAAIYIAGSSTKMPADVTAALEEVI 596

Query: 329 MKEGCQSEDAARKWLKHLERVGRYHVEAW 243
+E SE+ A WL+ LER G++H E W
Sbjct: 597 CQETGCSEEEASIWLRKLERNGKFHTETW 625


>tr|A2ZXJ4|A2ZXJ4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003266 PE=4 SV=1
Length = 549

Score = 122 bits (306), Expect = 1e-26
Identities = 56/89 (62%), Positives = 71/89 (79%)
Frame = -2

Query: 509 GGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVV 330
GGGFF AFSRDQP+KVYVQH+I E SA+VW +L+SG A+Y+AGS+ KMPADV AALE+V+
Sbjct: 460 GGGFFVAFSRDQPQKVYVQHRIREQSARVWNLLKSGAAIYIAGSSTKMPADVTAALEEVI 519

Query: 329 MKEGCQSEDAARKWLKHLERVGRYHVEAW 243
+E SE+ A WL+ LER G++H E W
Sbjct: 520 CQETGCSEEEASIWLRKLERNGKFHTETW 548


>tr|Q9SRU4|Q9SRU4_ARATH Putative NADPH-ferrihemoprotein reductase
OS=Arabidopsis thaliana GN=F14P3.7 PE=4 SV=1
Length = 616

Score = 119 bits (299), Expect = 7e-26
Identities = 57/91 (62%), Positives = 70/91 (76%), Gaps = 1/91 (1%)
Frame = -2

Query: 512 KGGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKV 333
KGGGF+ AFSRDQP+KVYVQHKI E S +VW +L G AVYVAGS+ KMP DV +A E +
Sbjct: 525 KGGGFYTAFSRDQPKKVYVQHKIREMSKRVWDLLCDGAAVYVAGSSTKMPCDVMSAFEDI 584

Query: 332 VMKE-GCQSEDAARKWLKHLERVGRYHVEAW 243
V +E G S++ A +WLK LE+ GRY+VEAW
Sbjct: 585 VSEETGGGSKEVASRWLKALEKTGRYNVEAW 615


>tr|Q6NPS8|Q6NPS8_ARATH At3g02280 (Putative uncharacterized protein
At3g02280) OS=Arabidopsis thaliana GN=At3g02280 PE=2
SV=1
Length = 623

Score = 119 bits (299), Expect = 7e-26
Identities = 57/91 (62%), Positives = 70/91 (76%), Gaps = 1/91 (1%)
Frame = -2

Query: 512 KGGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKV 333
KGGGF+ AFSRDQP+KVYVQHKI E S +VW +L G AVYVAGS+ KMP DV +A E +
Sbjct: 532 KGGGFYTAFSRDQPKKVYVQHKIREMSKRVWDLLCDGAAVYVAGSSTKMPCDVMSAFEDI 591

Query: 332 VMKE-GCQSEDAARKWLKHLERVGRYHVEAW 243
V +E G S++ A +WLK LE+ GRY+VEAW
Sbjct: 592 VSEETGGGSKEVASRWLKALEKTGRYNVEAW 622


>tr|B4FCZ6|B4FCZ6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 315

Score = 119 bits (299), Expect = 7e-26
Identities = 55/90 (61%), Positives = 69/90 (76%)
Frame = -2

Query: 512 KGGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKV 333
+GGGFF AFSRDQP+KVYVQHKI E S++VW +L S +Y+AGS+ KMPADV AALE+V
Sbjct: 225 RGGGFFVAFSRDQPQKVYVQHKIMEQSSRVWNLLLSDAVIYIAGSSTKMPADVTAALEEV 284

Query: 332 VMKEGCQSEDAARKWLKHLERVGRYHVEAW 243
+ KEG + A KWL+ LER GR ++E W
Sbjct: 285 ICKEGGVKQADASKWLRDLERAGRLNIETW 314


>tr|A7PAP2|A7PAP2_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038202001
PE=4 SV=1
Length = 626

Score = 119 bits (298), Expect = 9e-26
Identities = 53/90 (58%), Positives = 68/90 (75%)
Frame = -2

Query: 512 KGGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKV 333
KGGGF AFSRDQP KVYVQHK+ E S ++W +L G ++YVAGS+ KMP+DVF+ E++
Sbjct: 536 KGGGFCVAFSRDQPHKVYVQHKMRENSQRIWNLLCEGASIYVAGSSTKMPSDVFSCFEEI 595

Query: 332 VMKEGCQSEDAARKWLKHLERVGRYHVEAW 243
V KE ++A +WL+ LER GRYHVEAW
Sbjct: 596 VSKENGVPRESAVRWLRALERAGRYHVEAW 625


>tr|B6T7V0|B6T7V0_MAIZE NADPH reductase TAH18 OS=Zea mays PE=2 SV=1
Length = 635

Score = 117 bits (294), Expect = 3e-25
Identities = 54/90 (60%), Positives = 68/90 (75%)
Frame = -2

Query: 512 KGGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKV 333
+GGGFF AFSRDQP+KVYVQHKI E S++VW +L S +Y+AGS+ KMPADV ALE+V
Sbjct: 545 RGGGFFVAFSRDQPQKVYVQHKIMEQSSRVWNLLLSDAVIYIAGSSTKMPADVTXALEEV 604

Query: 332 VMKEGCQSEDAARKWLKHLERVGRYHVEAW 243
+ KEG + A KWL+ LER GR ++E W
Sbjct: 605 ICKEGGVKQADASKWLRDLERAGRLNIETW 634


>tr|A2Q1Q9|A2Q1Q9_MEDTR Flavoprotein pyridine nucleotide cytochrome
reductase OS=Medicago truncatula
GN=MtrDRAFT_AC148995g35v2 PE=4 SV=1
Length = 319

Score = 117 bits (293), Expect = 3e-25
Identities = 50/89 (56%), Positives = 68/89 (76%)
Frame = -2

Query: 509 GGGFFAAFSRDQPRKVYVQHKIEEYSAKVWAMLQSGCAVYVAGSAVKMPADVFAALEKVV 330
GGGF+ AFSRDQP KVYVQHK+ E+S +VW +L G +VY+AGS KMP DV +A E++V
Sbjct: 230 GGGFYVAFSRDQPEKVYVQHKLREHSGRVWNLLAEGASVYIAGSLTKMPTDVTSAFEEIV 289

Query: 329 MKEGCQSEDAARKWLKHLERVGRYHVEAW 243
KE S++ A +W++ LE+ G+YH+EAW
Sbjct: 290 SKENDVSKEDAVRWIRALEKCGKYHIEAW 318