BP914428
Clone id YMU001_000058_G08
Library
Length 435
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000058_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGGTCATGGGTGAAGGGGAAGTTGAAGCTAAGATACCTCGAATACTCCCTAAAGCCGATA
GATCTCAGAAACAAGTTCACGCTTTCTTCCGCCTCCACCCTGCCTTCCTTAACCCATAGC
ACCTGCTTCATACGCACATTATGGAAGATCTTTCTGACACTCACCTCGCCATAATGCAGA
TGAGGAGATAGTAAGGAAGTGGTGGCACTACCTACTTGCTGTCTATATGCTGCATATTCC
ATCAAAGACCCATTGATGAATGACTCCAAGGCCCTATCAGCATTGGCCCAACCAGGCTGC
CATGCCCGTGCTAACAATGCATAGCTAGCTTTCTCCAACTCATCCTCCAGATCCAAGTCC
TCAATGGAGCAACTTAGCGAGGGTCCTGGAAACTTCAAGATTCGTTTGGGAGGTAGAATT
GGAGCCTCCGGCTCA
■■Homology search results ■■ -
sp_hit_id Q43125
Definition sp|Q43125|CRY1_ARATH Cryptochrome-1 OS=Arabidopsis thaliana
Align length 140
Score (bit) 170.0
E-value 2.0e-42
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914428|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_G08.
(422 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q43125|CRY1_ARATH Cryptochrome-1 OS=Arabidopsis thaliana GN=C... 170 2e-42
sp|Q96524|CRY2_ARATH Cryptochrome-2 OS=Arabidopsis thaliana GN=C... 143 3e-34
sp|P40115|CRY1_SINAL Cryptochrome-1 OS=Sinapis alba GN=PHR1 PE=2... 139 3e-33
sp|P05327|PHR_SYNP6 Deoxyribodipyrimidine photo-lyase OS=Synecho... 43 6e-04
sp|P12768|PHR_STRGR Deoxyribodipyrimidine photo-lyase OS=Strepto... 42 0.001
sp|P34205|PHR_CARAU Deoxyribodipyrimidine photo-lyase OS=Carassi... 42 0.001
sp|Q55081|PHR_SYNY3 Deoxyribodipyrimidine photo-lyase OS=Synecho... 39 0.006
sp|Q05380|YAT1_SYNP1 Uncharacterized 31.6 kDa protein in atpI 5'... 37 0.032
sp|Q28811|PHR_POTTR Deoxyribodipyrimidine photo-lyase OS=Potorou... 37 0.041
sp|P61497|PHR_THET8 Deoxyribodipyrimidine photo-lyase OS=Thermus... 33 0.35
sp|P61496|PHR_THET2 Deoxyribodipyrimidine photo-lyase OS=Thermus... 33 0.35
sp|Q66AF7|ARAB_YERPS Ribulokinase OS=Yersinia pseudotuberculosis... 30 5.0
sp|Q1CIX8|ARAB_YERPN Ribulokinase OS=Yersinia pestis bv. Antiqua... 30 5.0
sp|P58543|ARAB_YERPE Ribulokinase OS=Yersinia pestis GN=araB PE=... 30 5.0
sp|Q1C7J2|ARAB_YERPA Ribulokinase OS=Yersinia pestis bv. Antiqua... 30 5.0
sp|Q55DU7|GDT4_DICDI Probable serine/threonine-protein kinase gd... 29 6.6

>sp|Q43125|CRY1_ARATH Cryptochrome-1 OS=Arabidopsis thaliana GN=CRY1
PE=1 SV=1
Length = 681

Score = 170 bits (431), Expect = 2e-42
Identities = 83/140 (59%), Positives = 101/140 (72%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPK+I+ G C EK S ALLARAW PGW+N D+AL +FING L
Sbjct: 175 PLLPPKKIIS--GDVSKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPL 232

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ R++ SATTS LSPHLH+GEVSVRK+FH VR+KQV W EG EESVNLFL+
Sbjct: 233 LEYSKNRRKADSATTSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLK 292

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRY+SFN P++H+
Sbjct: 293 SIGLREYSRYISFNHPYSHE 312


>sp|Q96524|CRY2_ARATH Cryptochrome-2 OS=Arabidopsis thaliana GN=CRY2
PE=1 SV=2
Length = 612

Score = 143 bits (360), Expect = 3e-34
Identities = 70/140 (50%), Positives = 92/140 (65%), Gaps = 3/140 (2%)
Frame = -1

Query: 413 PPKRILKFPGPS---LSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
PP R++ + +CSI EK S ALL RAW PGW+NAD+ L FI L
Sbjct: 170 PPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQL 229

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
++YA ++V +TSLLSP+LH+GE+SVR +F RMKQ++W ++ E EES +LFLR
Sbjct: 230 IDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLR 289

Query: 62 SIGFREYSRYLSFNFPFTHD 3
IG REYSRY+ FNFPFTH+
Sbjct: 290 GIGLREYSRYICFNFPFTHE 309


>sp|P40115|CRY1_SINAL Cryptochrome-1 OS=Sinapis alba GN=PHR1 PE=2
SV=1
Length = 501

Score = 139 bits (351), Expect = 3e-33
Identities = 67/139 (48%), Positives = 91/139 (65%), Gaps = 2/139 (1%)
Frame = -1

Query: 413 PPKRILKFPGPSL--SCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSLM 240
PP R++ +CS+ EK S ALL RAW PGW+NAD+ L FI L+
Sbjct: 170 PPWRLMPLSAAETVWACSVEELGLENEAEKPSNALLTRAWSPGWSNADKILNEFIEKQLI 229

Query: 239 EYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLRS 60
+YA ++V +TSLLSP+LH+GE+SVR++F RMKQ++W ++ E EES +LFLR
Sbjct: 230 DYAKNSKKVVGNSTSLLSPYLHFGEISVRRVFQCARMKQIIWARDKNGEGEESADLFLRG 289

Query: 59 IGFREYSRYLSFNFPFTHD 3
IG R+YSR + FNFPFTH+
Sbjct: 290 IGLRDYSRIICFNFPFTHE 308


>sp|P05327|PHR_SYNP6 Deoxyribodipyrimidine photo-lyase
OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 /
SAUG 1402/1) GN=phr PE=1 SV=4
Length = 484

Score = 42.7 bits (99), Expect = 6e-04
Identities = 25/99 (25%), Positives = 48/99 (48%)
Frame = -1

Query: 299 QPGWANADRALESFINGSLMEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQV 120
+PG A L+ F + ++ +Y R A TS LSP L +G + +R+ +
Sbjct: 207 EPGETAAIARLQEFCDRAIADYDPQRNFPAEAGTSGLSPALKFGAIGIRQAWRAASAAHA 266

Query: 119 LWVKEGRVEAEESVNLFLRSIGFREYSRYLSFNFPFTHD 3
L + EA S+ ++ + + +RE+ ++ ++FP D
Sbjct: 267 LSRSD---EARNSIRVWQQELAWREFYQHALYHFPSLAD 302


>sp|P12768|PHR_STRGR Deoxyribodipyrimidine photo-lyase
OS=Streptomyces griseus GN=phr PE=3 SV=1
Length = 455

Score = 42.0 bits (97), Expect = 0.001
Identities = 18/50 (36%), Positives = 28/50 (56%)
Frame = -1

Query: 275 RALESFINGSLMEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMK 126
+ + S++NG + +Y + TS LSPHLH+G VS ++ H R K
Sbjct: 206 KLVTSWLNGPMADYEDGHDDLAGDATSRLSPHLHFGTVSAAELVHRAREK 255


>sp|P34205|PHR_CARAU Deoxyribodipyrimidine photo-lyase OS=Carassius
auratus GN=phr PE=2 SV=1
Length = 556

Score = 42.0 bits (97), Expect = 0.001
Identities = 30/96 (31%), Positives = 46/96 (47%)
Frame = -1

Query: 299 QPGWANADRALESFINGSLMEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQV 120
QPG + LESFI+ L +A +R S LSP +H G++S +++ V+ ++
Sbjct: 308 QPGTSGGMNMLESFIDQRLRLFATHRNNPNYDALSHLSPWIHTGQLSAQRVVKQVKREK- 366

Query: 119 LWVKEGRVEAEESVNLFLRSIGFREYSRYLSFNFPF 12
A ESV F+ + R R L+ NF F
Sbjct: 367 --------NASESVASFIEELVVR---RELADNFCF 391


>sp|Q55081|PHR_SYNY3 Deoxyribodipyrimidine photo-lyase
OS=Synechocystis sp. (strain PCC 6803) GN=phrA PE=1 SV=1
Length = 488

Score = 39.3 bits (90), Expect = 0.006
Identities = 25/94 (26%), Positives = 44/94 (46%)
Frame = -1

Query: 296 PGWANADRALESFINGSLMEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVL 117
PG A++ L+ F+ L EY R TS LS L +G +S R ++
Sbjct: 222 PGEEAAEQRLDWFVAHGLEEYQQNRNFPALDGTSQLSAALKFGVISPRTLWQTTLEA--- 278

Query: 116 WVKEGRVEAEESVNLFLRSIGFREYSRYLSFNFP 15
W + EA S+ + + + +RE+ ++ ++FP
Sbjct: 279 WEQSRSEEARASIETWQQELAWREFYQHCLYSFP 312


>sp|Q05380|YAT1_SYNP1 Uncharacterized 31.6 kDa protein in atpI
5'region OS=Synechococcus sp. (strain PCC 6716) PE=4
SV=1
Length = 284

Score = 37.0 bits (84), Expect = 0.032
Identities = 23/85 (27%), Positives = 39/85 (45%)
Frame = -1

Query: 296 PGWANADRALESFINGSLMEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVL 117
PG A A + L F ++ EY R G T+LLSP L +G + +R ++ +
Sbjct: 203 PGEAAAAQQLAHFSQHAIYEYGEQRNYPGRPGTALLSPALKFGVIGIRTVW---AASEAA 259

Query: 116 WVKEGRVEAEESVNLFLRSIGFREY 42
EA S+ + + + +RE+
Sbjct: 260 LEHARSDEARASIRTWQQELAWREF 284


>sp|Q28811|PHR_POTTR Deoxyribodipyrimidine photo-lyase OS=Potorous
tridactylus GN=PHR PE=2 SV=1
Length = 532

Score = 36.6 bits (83), Expect = 0.041
Identities = 30/96 (31%), Positives = 45/96 (46%)
Frame = -1

Query: 299 QPGWANADRALESFINGSLMEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQV 120
+PG A+ L+SFI L + + R S LSP H+G+VSV+ + +
Sbjct: 297 KPGTASGLTMLQSFIAERLPYFGSDRNNPNKDALSNLSPWFHFGQVSVQ--------RAI 348

Query: 119 LWVKEGRVEAEESVNLFLRSIGFREYSRYLSFNFPF 12
L V++ R +SV F+ R R L+ NF F
Sbjct: 349 LEVQKHRSRYPDSVTNFVEEAVVR---RELADNFCF 381


>sp|P61497|PHR_THET8 Deoxyribodipyrimidine photo-lyase OS=Thermus
thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=phr
PE=1 SV=1
Length = 420

Score = 33.5 bits (75), Expect = 0.35
Identities = 25/96 (26%), Positives = 42/96 (43%)
Frame = -1

Query: 299 QPGWANADRALESFINGSLMEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQV 120
+PG A L +F+ L YA R ++ S LSP+ G +S R
Sbjct: 176 EPGEEAALAGLRAFLEAKLPRYAEERDRLDGEGGSRLSPYFALGVLSPR---------LA 226

Query: 119 LWVKEGRVEAEESVNLFLRSIGFREYSRYLSFNFPF 12
W E R E ++ + +R++S +L ++FP+
Sbjct: 227 AWEAERR--GGEGARKWVAELLWRDFSYHLLYHFPW 260


tr_hit_id O82769
Definition tr|O82769|O82769_ADICA Blue-light photoreceptor OS=Adiantum capillus-veneris
Align length 139
Score (bit) 246.0
E-value 5.0e-64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914428|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_G08.
(422 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|O82769|O82769_ADICA Blue-light photoreceptor OS=Adiantum capi... 246 5e-64
tr|O82786|O82786_ADICA Blue-light photoreceptor OS=Adiantum capi... 206 4e-52
tr|Q309E8|Q309E8_NICSY Cryptochrome 1 OS=Nicotiana sylvestris GN... 180 4e-44
tr|B8K2A4|B8K2A4_SOYBN Cryptochrome 1 OS=Glycine max PE=2 SV=1 177 3e-43
tr|Q9XHD8|Q9XHD8_SOLLC Cryptochrome 1 OS=Solanum lycopersicum PE... 175 9e-43
tr|B8LPX1|B8LPX1_PICSI Putative uncharacterized protein OS=Picea... 174 2e-42
tr|A2Q6E2|A2Q6E2_MEDTR Deoxyribodipyrimidine photolyase, class 1... 174 2e-42
tr|Q6YBV9|Q6YBV9_PEA Cryptochrome 1 (Cryptochrome 1 apoprotein) ... 173 4e-42
tr|B6REW9|B6REW9_VITVI Cryptochrome 1 OS=Vitis vinifera GN=CRY1 ... 172 1e-41
tr|B6REW8|B6REW8_VITRI Cryptochrome 1 OS=Vitis riparia GN=CRY1 P... 172 1e-41
tr|A7NUY5|A7NUY5_VITVI Chromosome chr18 scaffold_1, whole genome... 172 1e-41
tr|Q6V4K2|Q6V4K2_OROMI Cryptochrome 1 OS=Orobanche minor PE=2 SV=1 171 2e-41
tr|Q1JU52|Q1JU52_BRANA Cryptochrome1 OS=Brassica napus GN=cry1 P... 170 3e-41
tr|Q6EAN1|Q6EAN1_PEA Mutant cryptochrome 1-1 protein OS=Pisum sa... 170 4e-41
tr|Q9S7R6|Q9S7R6_ADICA Blue light photoreceptor OS=Adiantum capi... 169 5e-41
tr|Q9S794|Q9S794_ADICA Blue light photoreceptor OS=Adiantum capi... 168 1e-40
tr|O82779|O82779_ADICA Blue-light photoreceptor OS=Adiantum capi... 168 1e-40
tr|Q93VS0|Q93VS0_SOLLC Cryptochrome 1b OS=Solanum lycopersicum G... 164 2e-39
tr|Q0GKU4|Q0GKU4_BRACM Cryptochrome 1 protein OS=Brassica campes... 162 8e-39
tr|B8A2L5|B8A2L5_MAIZE Putative uncharacterized protein OS=Zea m... 162 1e-38
tr|Q8H6B3|Q8H6B3_SORBI Cryptochrome 2 apoprotein OS=Sorghum bico... 160 2e-38
tr|Q5MD22|Q5MD22_SORBI Cryptochrome 2 OS=Sorghum bicolor PE=4 SV=1 160 2e-38
tr|Q948J4|Q948J4_ORYSJ Cryptochrome 1b OS=Oryza sativa subsp. ja... 160 4e-38
tr|Q7XV36|Q7XV36_ORYSJ OSJNBa0086B14.23 protein OS=Oryza sativa ... 160 4e-38
tr|Q0JCS3|Q0JCS3_ORYSJ Os04g0452100 protein OS=Oryza sativa subs... 160 4e-38
tr|Q01J88|Q01J88_ORYSA H0815C01.8 protein OS=Oryza sativa GN=H08... 160 4e-38
tr|B8AUF2|B8AUF2_ORYSI Putative uncharacterized protein OS=Oryza... 160 4e-38
tr|A3AUD5|A3AUD5_ORYSJ Putative uncharacterized protein OS=Oryza... 160 4e-38
tr|Q948J6|Q948J6_ORYSJ Cryptochrome 1a OS=Oryza sativa subsp. ja... 159 5e-38
tr|Q6YXC2|Q6YXC2_ORYSJ Os02g0573200 protein OS=Oryza sativa subs... 159 5e-38

>tr|O82769|O82769_ADICA Blue-light photoreceptor OS=Adiantum
capillus-veneris GN=CRY2 PE=2 SV=1
Length = 679

Score = 246 bits (627), Expect = 5e-64
Identities = 124/139 (89%), Positives = 126/139 (90%)
Frame = -1

Query: 419 ILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSLM 240
ILPPKRILKFPGPSLSCSI EK S ALLARAWQPGWANADRALESFINGSLM
Sbjct: 172 ILPPKRILKFPGPSLSCSIEDLDLEDELEKGSNALLARAWQPGWANADRALESFINGSLM 231

Query: 239 EYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLRS 60
EYAA RQ+V SATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLRS
Sbjct: 232 EYAANRQKVDSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLRS 291

Query: 59 IGFREYSRYLSFNFPFTHD 3
IGFREYSRYLSFNFPFTH+
Sbjct: 292 IGFREYSRYLSFNFPFTHE 310


>tr|O82786|O82786_ADICA Blue-light photoreceptor OS=Adiantum
capillus-veneris GN=CRY1 PE=2 SV=1
Length = 637

Score = 206 bits (525), Expect = 4e-52
Identities = 101/140 (72%), Positives = 115/140 (82%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI K+PG + + I EK S LLARAW PGWANADRALE+F++G L
Sbjct: 165 PLLPPKRITKWPGIAATSPIEDLELENESEKGSNDLLARAWAPGWANADRALEAFVSGPL 224

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
MEYA+ RQ+V SATTSLLSPHLHYGE+SVRK+FH+VRMKQVLWVKEG +AEESVNLFLR
Sbjct: 225 MEYASNRQKVDSATTSLLSPHLHYGELSVRKVFHSVRMKQVLWVKEGNADAEESVNLFLR 284

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRYL FNFPFTH+
Sbjct: 285 SIGLREYSRYLCFNFPFTHE 304


>tr|Q309E8|Q309E8_NICSY Cryptochrome 1 OS=Nicotiana sylvestris
GN=cry1 PE=2 SV=1
Length = 681

Score = 180 bits (456), Expect = 4e-44
Identities = 87/140 (62%), Positives = 106/140 (75%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI+ PG + CS EK S ALLARAW PGW+NAD+AL +F+NG L
Sbjct: 168 PLLPPKRII--PGDASRCSSDSLVFEDESEKGSNALLARAWSPGWSNADKALTTFVNGPL 225

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ R++ SATTS LSPHLH+GEVSVRK+FH VR+KQVLW EG EESVNLFL+
Sbjct: 226 LEYSQNRRKADSATTSFLSPHLHFGEVSVRKVFHFVRIKQVLWANEGNKAGEESVNLFLK 285

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRY+SFN P++H+
Sbjct: 286 SIGLREYSRYMSFNHPYSHE 305


>tr|B8K2A4|B8K2A4_SOYBN Cryptochrome 1 OS=Glycine max PE=2 SV=1
Length = 681

Score = 177 bits (448), Expect = 3e-43
Identities = 86/140 (61%), Positives = 107/140 (76%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI+ PG + C EKAS ALLARAW PGW+NA++AL +FING L
Sbjct: 168 PLLPPKRII--PGDASRCPSDTLLFEDELEKASNALLARAWSPGWSNANKALTTFINGPL 225

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ R++ SATTSLLSPHLH+GE+SV+K+FH VR+KQVLW EG EESVNLFL+
Sbjct: 226 IEYSKNRRKADSATTSLLSPHLHFGELSVKKVFHLVRIKQVLWANEGNKAGEESVNLFLK 285

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRY+SFN P++H+
Sbjct: 286 SIGLREYSRYISFNHPYSHE 305


>tr|Q9XHD8|Q9XHD8_SOLLC Cryptochrome 1 OS=Solanum lycopersicum PE=2
SV=1
Length = 679

Score = 175 bits (444), Expect = 9e-43
Identities = 85/140 (60%), Positives = 104/140 (74%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI+ G + C EK S ALLARAW PGW+NAD+AL +F+NG L
Sbjct: 168 PLLPPKRIIS--GDASRCPSDNLVFEDESEKGSNALLARAWSPGWSNADKALTTFVNGPL 225

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ R++ SATTS LSPHLH+GEVSVRK+FH VR+KQVLW EG EESVNLFL+
Sbjct: 226 LEYSQNRRKADSATTSFLSPHLHFGEVSVRKVFHFVRIKQVLWANEGNKAGEESVNLFLK 285

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRY+SFN P++H+
Sbjct: 286 SIGLREYSRYMSFNHPYSHE 305


>tr|B8LPX1|B8LPX1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 655

Score = 174 bits (441), Expect = 2e-42
Identities = 85/140 (60%), Positives = 106/140 (75%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI+ G +C EKAS ALLARAW PGW++AD+AL +FING L
Sbjct: 167 PLLPPKRIVA--GEVSNCPSDDLNLEDESEKASNALLARAWSPGWSSADKALTAFINGPL 224

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
++YA RQ+ SATTSLLSPHLH+GE+SV+K+FH +R++QVLW EG E+SVNLFL+
Sbjct: 225 LDYAINRQKADSATTSLLSPHLHFGELSVKKVFHLLRIRQVLWANEGNTSGEQSVNLFLK 284

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRYLSFNFP +H+
Sbjct: 285 SIGLREYSRYLSFNFPSSHE 304


>tr|A2Q6E2|A2Q6E2_MEDTR Deoxyribodipyrimidine photolyase, class 1
OS=Medicago truncatula GN=MtrDRAFT_AC174468g14v1 PE=4
SV=1
Length = 679

Score = 174 bits (441), Expect = 2e-42
Identities = 85/140 (60%), Positives = 104/140 (74%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI+ PG C EKAS ALLARAW PGW+NA++AL +FING L
Sbjct: 170 PLLPPKRII--PGDVSKCPSDTLVFEDDLEKASNALLARAWSPGWSNANKALTTFINGPL 227

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ R++ SATTS LSPHLH+GEVSV+K+FH VR+KQV W EG EESVNLFL+
Sbjct: 228 IEYSKNRRKADSATTSFLSPHLHFGEVSVKKVFHLVRIKQVFWANEGNEAGEESVNLFLK 287

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRY+SFN P++H+
Sbjct: 288 SIGLREYSRYISFNHPYSHE 307


>tr|Q6YBV9|Q6YBV9_PEA Cryptochrome 1 (Cryptochrome 1 apoprotein)
OS=Pisum sativum GN=CRY1 PE=2 SV=1
Length = 682

Score = 173 bits (438), Expect = 4e-42
Identities = 84/140 (60%), Positives = 104/140 (74%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI+ PG C EK+S ALLARAW PGW+NA++AL +FING L
Sbjct: 168 PLLPPKRII--PGDVSRCPSDTLVFEDELEKSSNALLARAWSPGWSNANKALTTFINGPL 225

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ R++ SATTS LSPHLH+GEVSV+K+FH VR+KQV W EG EESVNLFL+
Sbjct: 226 IEYSVNRRKADSATTSFLSPHLHFGEVSVKKVFHLVRIKQVFWANEGNKAGEESVNLFLK 285

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRY+SFN P++H+
Sbjct: 286 SIGLREYSRYISFNHPYSHE 305


>tr|B6REW9|B6REW9_VITVI Cryptochrome 1 OS=Vitis vinifera GN=CRY1
PE=4 SV=1
Length = 681

Score = 172 bits (435), Expect = 1e-41
Identities = 87/140 (62%), Positives = 101/140 (72%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI PG C EK S ALLARAW PGW+NAD+AL FING L
Sbjct: 168 PLLPPKRIN--PGDVSRCPSDTIAFEDESEKGSNALLARAWTPGWSNADKALTIFINGPL 225

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ ++ SATTS LSPHLH+GEVSVRK+FH VR+KQVLW EG EESVNLFL+
Sbjct: 226 IEYSKNSRKADSATTSFLSPHLHFGEVSVRKVFHLVRIKQVLWANEGNKAGEESVNLFLK 285

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRYLSFN P++H+
Sbjct: 286 SIGLREYSRYLSFNHPYSHE 305


>tr|B6REW8|B6REW8_VITRI Cryptochrome 1 OS=Vitis riparia GN=CRY1 PE=4
SV=1
Length = 681

Score = 172 bits (435), Expect = 1e-41
Identities = 87/140 (62%), Positives = 101/140 (72%)
Frame = -1

Query: 422 PILPPKRILKFPGPSLSCSIXXXXXXXXXEKASYALLARAWQPGWANADRALESFINGSL 243
P+LPPKRI PG C EK S ALLARAW PGW+NAD+AL FING L
Sbjct: 168 PLLPPKRIN--PGDVSRCPSDTIAFEDESEKGSNALLARAWTPGWSNADKALTIFINGPL 225

Query: 242 MEYAAYRQQVGSATTSLLSPHLHYGEVSVRKIFHNVRMKQVLWVKEGRVEAEESVNLFLR 63
+EY+ ++ SATTS LSPHLH+GEVSVRK+FH VR+KQVLW EG EESVNLFL+
Sbjct: 226 IEYSKNSRKADSATTSFLSPHLHFGEVSVRKVFHLVRIKQVLWANEGNKAGEESVNLFLK 285

Query: 62 SIGFREYSRYLSFNFPFTHD 3
SIG REYSRYLSFN P++H+
Sbjct: 286 SIGLREYSRYLSFNHPYSHE 305