BP914469
Clone id YMU001_000059_C05
Library
Length 551
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000059_C05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACAAACTAATTTTCTTGTCAGAGTGAATAATCATACACCAACCCGGTGTATGAAATAAG
AATCGATGTGTTCGCAAGGAAAAAACATGATATACATAAAGTGAACTTCTTCTTGTAATG
AAAGCAAGAAATTCGTCCTCATCTATAACGAATAGTAGCAAAACTGGACCCAATGTTCTC
GAGTCTCTTGGAATTGCCAAGAATGTTACCTGTATGTCAGCTGCACTTTGCCAAAATGAG
GTAAAAACTTATTGGGATACATAACATTCGATAATTCTCTTTAACCTGTGAAGAGAGAAT
CAAAAGTCTAGGAGGAGTTGTGGCAAAATTCTTTCCAGGTGGGTAGCTTCAATTGTTACC
ATACCTTCAGCCTCGGCAATTAGGGCAGCCCGTTGTATTGCTTCTGAGACAAAAAGCCTC
AGCAGCTCACAGCTTAACTTCAAAGAATTTGTATTGGCTGTCGTGGCTCTCTTCTTCTTT
GTCAAAAGCGGTCCAGCCATACTTCTGCCTCTAGAGCCCCCTCTTCTTGCTTCTGTTCTT
TTTCTTTTGAG
■■Homology search results ■■ -
sp_hit_id Q2NKU0
Definition sp|Q2NKU0|STR13_BOVIN Stimulated by retinoic acid gene 13 protein homolog OS=Bos taurus
Align length 48
Score (bit) 50.1
E-value 7.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914469|Adiantum capillus-veneris mRNA, clone:
YMU001_000059_C05.
(551 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2NKU0|STR13_BOVIN Stimulated by retinoic acid gene 13 protei... 50 7e-06
sp|Q8C4X1|STR13_MOUSE Stimulated by retinoic acid gene 13 protei... 48 3e-05
sp|Q5RBU1|STR13_PONAB Stimulated by retinoic acid gene 13 protei... 47 8e-05
sp|A8MT69|STR13_HUMAN Stimulated by retinoic acid gene 13 protei... 47 8e-05

>sp|Q2NKU0|STR13_BOVIN Stimulated by retinoic acid gene 13 protein
homolog OS=Bos taurus GN=STRA13 PE=3 SV=1
Length = 79

Score = 50.1 bits (118), Expect = 7e-06
Identities = 24/48 (50%), Positives = 35/48 (72%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+L+L ELL++FV EA R+ A+AEG+ ++ LE++LPQLLLDF
Sbjct: 32 ALQLVAELLKIFVVEAAIRSVRQAQAEGLAHVDVEQLEKVLPQLLLDF 79


>sp|Q8C4X1|STR13_MOUSE Stimulated by retinoic acid gene 13 protein
OS=Mus musculus GN=Stra13 PE=2 SV=1
Length = 78

Score = 48.1 bits (113), Expect = 3e-05
Identities = 24/48 (50%), Positives = 32/48 (66%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+L+L E LR+FV EA R A+AE + +E LE++LPQLLLDF
Sbjct: 31 ALQLMAEFLRIFVLEAAVRGVWQAQAEDLDVVEVDQLEKVLPQLLLDF 78


>sp|Q5RBU1|STR13_PONAB Stimulated by retinoic acid gene 13 protein
OS=Pongo abelii GN=STRA13 PE=3 SV=1
Length = 81

Score = 46.6 bits (109), Expect = 8e-05
Identities = 23/48 (47%), Positives = 33/48 (68%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+L+L ELL++FV EA R A+AE + ++ LE++LPQLLLDF
Sbjct: 34 ALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF 81


>sp|A8MT69|STR13_HUMAN Stimulated by retinoic acid gene 13 protein
homolog OS=Homo sapiens GN=STRA13 PE=2 SV=1
Length = 81

Score = 46.6 bits (109), Expect = 8e-05
Identities = 23/48 (47%), Positives = 33/48 (68%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+L+L ELL++FV EA R A+AE + ++ LE++LPQLLLDF
Sbjct: 34 ALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF 81


tr_hit_id Q8L7N3
Definition tr|Q8L7N3|Q8L7N3_ARATH Putative uncharacterized protein At1g78790 OS=Arabidopsis thaliana
Align length 48
Score (bit) 81.6
E-value 2.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914469|Adiantum capillus-veneris mRNA, clone:
YMU001_000059_C05.
(551 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8L7N3|Q8L7N3_ARATH Putative uncharacterized protein At1g7879... 82 2e-14
tr|Q7XUQ1|Q7XUQ1_ORYSJ Os04g0481500 protein OS=Oryza sativa subs... 79 2e-13
tr|Q25AJ9|Q25AJ9_ORYSA H0510A06.6 protein OS=Oryza sativa GN=H05... 79 2e-13
tr|A9PI92|A9PI92_POPTR Putative uncharacterized protein OS=Popul... 77 5e-13
tr|A9NXK2|A9NXK2_PICSI Putative uncharacterized protein OS=Picea... 77 5e-13
tr|A7PCM9|A7PCM9_VITVI Chromosome chr17 scaffold_12, whole genom... 77 5e-13
tr|Q9ZV97|Q9ZV97_ARATH F9K20.17 OS=Arabidopsis thaliana GN=F9K20... 62 2e-08
tr|A2AC07|A2AC07_MOUSE Stimulated by retinoic acid 13 OS=Mus mus... 48 3e-04
tr|Q019W8|Q019W8_OSTTA Homology to unknown gene OS=Ostreococcus ... 47 7e-04
tr|Q4SGM6|Q4SGM6_TETNG Chromosome 3 SCAF14593, whole genome shot... 46 0.001
tr|B7Q7G6|B7Q7G6_IXOSC Putative uncharacterized protein OS=Ixode... 45 0.003
tr|A2DLP6|A2DLP6_TRIVA Putative uncharacterized protein OS=Trich... 41 0.048
tr|A2FX12|A2FX12_TRIVA Putative uncharacterized protein OS=Trich... 39 0.14
tr|Q20071|Q20071_CAEEL Putative uncharacterized protein OS=Caeno... 34 4.5

>tr|Q8L7N3|Q8L7N3_ARATH Putative uncharacterized protein At1g78790
OS=Arabidopsis thaliana GN=At1g78790 PE=2 SV=1
Length = 104

Score = 81.6 bits (200), Expect = 2e-14
Identities = 41/48 (85%), Positives = 45/48 (93%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+LKLSCELL+ FVSEA+QRAA+IAEAEGM IEATHLERILPQLLLDF
Sbjct: 57 ALKLSCELLKSFVSEAVQRAAIIAEAEGMEKIEATHLERILPQLLLDF 104


>tr|Q7XUQ1|Q7XUQ1_ORYSJ Os04g0481500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0011N17.11 PE=4 SV=2
Length = 111

Score = 78.6 bits (192), Expect = 2e-13
Identities = 37/48 (77%), Positives = 44/48 (91%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+LK+SCELLR+FV+EA+QR+A IAEAEG TIE THLER+LPQLLLDF
Sbjct: 64 ALKVSCELLRIFVTEAVQRSAFIAEAEGTTTIEPTHLERVLPQLLLDF 111


>tr|Q25AJ9|Q25AJ9_ORYSA H0510A06.6 protein OS=Oryza sativa
GN=H0510A06.6 PE=4 SV=1
Length = 111

Score = 78.6 bits (192), Expect = 2e-13
Identities = 37/48 (77%), Positives = 44/48 (91%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+LK+SCELLR+FV+EA+QR+A IAEAEG TIE THLER+LPQLLLDF
Sbjct: 64 ALKVSCELLRIFVTEAVQRSAFIAEAEGTTTIEPTHLERVLPQLLLDF 111


>tr|A9PI92|A9PI92_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=4 SV=1
Length = 103

Score = 77.4 bits (189), Expect = 5e-13
Identities = 37/48 (77%), Positives = 44/48 (91%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+LKLSCELLR+F++EA+QR+A+IAEAEG IE THLERILPQLLLDF
Sbjct: 56 ALKLSCELLRIFITEAVQRSAMIAEAEGAGKIEGTHLERILPQLLLDF 103


>tr|A9NXK2|A9NXK2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 121

Score = 77.4 bits (189), Expect = 5e-13
Identities = 37/48 (77%), Positives = 42/48 (87%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+LKLSCE LRLFV+EA+QRAA++AE EG IE THLERILPQLLLDF
Sbjct: 74 ALKLSCEFLRLFVTEAVQRAAIVAEVEGSTQIEGTHLERILPQLLLDF 121


>tr|A7PCM9|A7PCM9_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015932001
PE=4 SV=1
Length = 137

Score = 77.4 bits (189), Expect = 5e-13
Identities = 39/48 (81%), Positives = 44/48 (91%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+LKLSCELLR+FV EA++RAA IAEAEG+ IEATHLERILPQLLLDF
Sbjct: 90 ALKLSCELLRVFVIEAVERAATIAEAEGVNKIEATHLERILPQLLLDF 137


>tr|Q9ZV97|Q9ZV97_ARATH F9K20.17 OS=Arabidopsis thaliana GN=F9K20.17
PE=4 SV=1
Length = 145

Score = 62.4 bits (150), Expect = 2e-08
Identities = 31/35 (88%), Positives = 33/35 (94%)
Frame = -1

Query: 407 SEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
SEA+QRAA+IAEAEGM IEATHLERILPQLLLDF
Sbjct: 111 SEAVQRAAIIAEAEGMEKIEATHLERILPQLLLDF 145


>tr|A2AC07|A2AC07_MOUSE Stimulated by retinoic acid 13 OS=Mus
musculus GN=Stra13 PE=4 SV=1
Length = 114

Score = 48.1 bits (113), Expect = 3e-04
Identities = 24/48 (50%), Positives = 32/48 (66%)
Frame = -1

Query: 446 SLKLSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
+L+L E LR+FV EA R A+AE + +E LE++LPQLLLDF
Sbjct: 67 ALQLMAEFLRIFVLEAAVRGVWQAQAEDLDVVEVDQLEKVLPQLLLDF 114


>tr|Q019W8|Q019W8_OSTTA Homology to unknown gene OS=Ostreococcus
tauri GN=Ot05g00520 PE=4 SV=1
Length = 90

Score = 47.0 bits (110), Expect = 7e-04
Identities = 21/41 (51%), Positives = 29/41 (70%)
Frame = -1

Query: 425 LLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
L+ F+ EA RA +A+ EG +IE H+ER+LPQL+LDF
Sbjct: 48 LVEAFIVEATARACALADIEGSRSIEGEHIERVLPQLMLDF 88


>tr|Q4SGM6|Q4SGM6_TETNG Chromosome 3 SCAF14593, whole genome shotgun
sequence OS=Tetraodon nigroviridis GN=GSTENG00018562001
PE=4 SV=1
Length = 124

Score = 45.8 bits (107), Expect = 0.001
Identities = 23/45 (51%), Positives = 30/45 (66%)
Frame = -1

Query: 437 LSCELLRLFVSEAIQRAALIAEAEGMVTIEATHLERILPQLLLDF 303
L E+LR+FV EA R+ AE+E ++ H E+ILPQLLLDF
Sbjct: 80 LMAEMLRIFVREAAVRSQKQAESEDCDQVDIEHFEKILPQLLLDF 124