BP914497
Clone id YMU001_000059_E10
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000059_E10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGCAGTAGAAATCGGCAAGTCGATGAATTTCTTTCTCTAGTTGTTTGTTTTATCCGCGG
GCTTGTTGTTGGTGGGCATCCGCTGGCGTGTTTATATGTGCACTCTCTCTGCATACGCCT
CGCAGAGACAAATTTGCATGCCACTAACCCGGGCAGATTTCTTGGCTCCAAGAAGTGGTT
GAAACTGCCTGCGTTACGTCTTCTGTGAGCCTGCTGCTCCACAATTCCAAGCTTGCTTTT
TGCAATTCAGCCTGATTTCTTGTTTTGGGTGCCCGTCAAGAAGATTTTAGGGTGCTTAGC
CGCAAATTAAGCAGTTGACGCAACCAAAATTACGAAATTTGGCAGGATTTGGGCTTCGCT
TGCCTAAGAACAGGCTCCGACATGGTAAGAATCTGCATTCTTGGCTCATGAAGAAGGTAG
AGACATGGGCTGCGGTTTTAGCAGGCACGAAGTGGCAGAGGAGCCTTTACCCAGCCCCAA
AAGCAGGTCATCGCGTCACTCGTCCTCGAC
■■Homology search results ■■ -
sp_hit_id Q2II25
Definition sp|Q2II25|PGK_ANADE Phosphoglycerate kinase OS=Anaeromyxobacter dehalogenans (strain 2CP-C)
Align length 37
Score (bit) 30.4
E-value 5.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914497|Adiantum capillus-veneris mRNA, clone:
YMU001_000059_E10.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2II25|PGK_ANADE Phosphoglycerate kinase OS=Anaeromyxobacter ... 30 5.0
sp|P56400|GP1BB_MOUSE Platelet glycoprotein Ib beta chain OS=Mus... 30 6.6
sp|Q04G42|PGK_OENOB Phosphoglycerate kinase OS=Oenococcus oeni (... 30 8.5
sp|Q7NI70|PGK_GLOVI Phosphoglycerate kinase OS=Gloeobacter viola... 30 8.5
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficienc... 30 8.6
sp|Q4V8B0|OXR1_RAT Oxidation resistance protein 1 OS=Rattus norv... 30 8.6
sp|Q77372|GAG_HV1AN Gag polyprotein OS=Human immunodeficiency vi... 30 8.6

>sp|Q2II25|PGK_ANADE Phosphoglycerate kinase OS=Anaeromyxobacter
dehalogenans (strain 2CP-C) GN=pgk PE=3 SV=1
Length = 396

Score = 30.4 bits (67), Expect = 5.0
Identities = 13/37 (35%), Positives = 21/37 (56%)
Frame = -1

Query: 243 AKSKLGIVEQQAHRRRNAGSFNHFLEPRNLPGLVACK 133
A + G+V++ H G+ F+E R LPG+ AC+
Sbjct: 359 AVEQAGLVDKMKHVSTGGGASLEFIEGRELPGVKACE 395


>sp|P56400|GP1BB_MOUSE Platelet glycoprotein Ib beta chain OS=Mus
musculus GN=Gp1bb PE=1 SV=1
Length = 206

Score = 30.0 bits (66), Expect = 6.6
Identities = 16/44 (36%), Positives = 23/44 (52%)
Frame = -3

Query: 448 VPAKTAAHVSTFFMSQECRFLPCRSLFLGKRSPNPAKFRNFGCV 317
+PA AAH+ +CR LP R+ G+ P A +R+ CV
Sbjct: 78 LPALRAAHLGANPWRCDCRLLPLRAWLAGR--PERAPYRDLRCV 119


>sp|Q04G42|PGK_OENOB Phosphoglycerate kinase OS=Oenococcus oeni
(strain BAA-331 / PSU-1) GN=pgk PE=3 SV=1
Length = 404

Score = 29.6 bits (65), Expect = 8.5
Identities = 14/35 (40%), Positives = 20/35 (57%)
Frame = -1

Query: 243 AKSKLGIVEQQAHRRRNAGSFNHFLEPRNLPGLVA 139
A S+LGI +Q H G+ +LE + LPG+ A
Sbjct: 366 AVSQLGIADQFTHISTGGGASLEYLEGKTLPGIAA 400


>sp|Q7NI70|PGK_GLOVI Phosphoglycerate kinase OS=Gloeobacter
violaceus GN=pgk PE=3 SV=1
Length = 407

Score = 29.6 bits (65), Expect = 8.5
Identities = 20/69 (28%), Positives = 32/69 (46%)
Frame = -1

Query: 345 LPNFVILVASTA*FAAKHPKIFLTGTQNKKSG*IAKSKLGIVEQQAHRRRNAGSFNHFLE 166
LP F + A A+ + + G + S A K G+V++ +H G+ FLE
Sbjct: 338 LPGFSKGTFAVAHALAESDNLSIVGGGDSAS---AAEKAGVVDKLSHVSTGGGASLEFLE 394

Query: 165 PRNLPGLVA 139
+ LPG+ A
Sbjct: 395 GKTLPGVAA 403


>sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency
virus type 1 (isolate ANT70 group O) GN=gag-pol PE=3
SV=3
Length = 1435

Score = 29.6 bits (65), Expect = 8.6
Identities = 17/53 (32%), Positives = 22/53 (41%)
Frame = -3

Query: 361 KRSPNPAKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 203
+R NP + G + C CG +GH + R KK W CG G Q
Sbjct: 383 QRGQNPIRK---GTIKCFNCG------KEGHIARNCRAPRKKGCWKCGQEGHQ 426


>sp|Q4V8B0|OXR1_RAT Oxidation resistance protein 1 OS=Rattus
norvegicus GN=Oxr1 PE=1 SV=2
Length = 758

Score = 29.6 bits (65), Expect = 8.6
Identities = 17/36 (47%), Positives = 18/36 (50%)
Frame = -2

Query: 110 RESAHINTPADAHQQQARG*NKQLEKEIHRLADFYC 3
RES H PADAH G + EK HRL F C
Sbjct: 439 RESKHRGAPADAH---GEGSSLLKEKRRHRLHKFLC 471


>sp|Q77372|GAG_HV1AN Gag polyprotein OS=Human immunodeficiency virus
type 1 (isolate ANT70 group O) GN=gag PE=3 SV=3
Length = 498

Score = 29.6 bits (65), Expect = 8.6
Identities = 17/53 (32%), Positives = 22/53 (41%)
Frame = -3

Query: 361 KRSPNPAKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 203
+R NP + G + C CG +GH + R KK W CG G Q
Sbjct: 383 QRGQNPIRK---GTIKCFNCG------KEGHIARNCRAPRKKGCWKCGQEGHQ 426


tr_hit_id Q8QDY9
Definition tr|Q8QDY9|Q8QDY9_9HIV1 Gag polyprotein (Fragment) OS=Human immunodeficiency virus 1
Align length 47
Score (bit) 33.5
E-value 6.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914497|Adiantum capillus-veneris mRNA, clone:
YMU001_000059_E10.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8QDY9|Q8QDY9_9HIV1 Gag polyprotein (Fragment) OS=Human immun... 33 6.1
tr|Q8QDX0|Q8QDX0_9HIV1 Gag polyprotein OS=Human immunodeficiency... 33 6.1

>tr|Q8QDY9|Q8QDY9_9HIV1 Gag polyprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=gag PE=4 SV=1
Length = 219

Score = 33.5 bits (75), Expect = 6.1
Identities = 17/47 (36%), Positives = 20/47 (42%)
Frame = -3

Query: 343 AKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 203
+ FR + C CG DGHP + R KK W CG G Q
Sbjct: 101 SNFRGPKRIKCFNCG------KDGHPARNCRAPRKKGCWKCGKEGHQ 141


>tr|Q8QDX0|Q8QDX0_9HIV1 Gag polyprotein OS=Human immunodeficiency
virus 1 GN=gag PE=4 SV=1
Length = 498

Score = 33.5 bits (75), Expect = 6.1
Identities = 17/47 (36%), Positives = 20/47 (42%)
Frame = -3

Query: 343 AKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 203
+ FR + C CG DGHP + R KK W CG G Q
Sbjct: 380 SNFRGPKRIKCFNCG------KDGHPARNCRAPRKKGCWKCGKEGHQ 420