BP914530
Clone id YMU001_000059_H08
Library
Length 473
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000059_H08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAAGGTGTTCCTACTAGCACATCGATGCAGGAAAATTCTATTTTTTCAGAGTCAAACTA
TGGAGATGATGTTTACGCTTATTGCAGATGCATTGCGAGAGACAGGTAAAGAAAAGGATC
ATCACCCCACCGATTTTCTTAATTTCTTCTGCCTCGGAAATCGGGAAGTGGTGCCTGAGG
ATGGATCAGCACCTACAACGCCAATTGATGACAAAAGCCCTCTGGCGCTAGCACAAAAGT
CTGGACGGTTCATGATATACGTGCATGCAAAGGGTATGATAGTTGATGATGAGTTTGTAA
TCCTTGGATCAGCCAATATAAATCAACGTTCTATGGATGGATCGAGAGATACTGAAATTG
CTATGGGTGCTTATCAAGCCCATAGAACATGGGCTAACAAGGGCTCTCATACTCATGGTC
AGGTTTACGGTTTTCGCATGTCTCTTTGGGCTGAGCACTTGCGTGGGCAGTAG
■■Homology search results ■■ -
sp_hit_id O23078
Definition sp|O23078|PLDB2_ARATH Phospholipase D beta 2 OS=Arabidopsis thaliana
Align length 145
Score (bit) 179.0
E-value 4.0e-45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914530|Adiantum capillus-veneris mRNA, clone:
YMU001_000059_H08.
(473 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O23078|PLDB2_ARATH Phospholipase D beta 2 OS=Arabidopsis thal... 179 4e-45
sp|Q9C5Y0|PLDD1_ARATH Phospholipase D delta OS=Arabidopsis thali... 176 5e-44
sp|Q9T051|PLDG2_ARATH Phospholipase D gamma 2 OS=Arabidopsis tha... 175 1e-43
sp|Q9T053|PLDG1_ARATH Phospholipase D gamma 1 OS=Arabidopsis tha... 174 2e-43
sp|P93733|PLDB1_ARATH Phospholipase D beta 1 OS=Arabidopsis thal... 173 4e-43
sp|Q9T052|PLDG3_ARATH Phospholipase D gamma 3 OS=Arabidopsis tha... 171 1e-42
sp|O04883|PLDA1_PIMBR Phospholipase D alpha 1 OS=Pimpinella brac... 151 2e-36
sp|P58766|PLDZ1_ARATH Phospholipase D zeta OS=Arabidopsis thalia... 150 3e-36
sp|O82549|PLDA1_BRAOC Phospholipase D alpha 1 OS=Brassica olerac... 149 6e-36
sp|P55939|PLDA2_BRAOC Phospholipase D alpha 2 OS=Brassica olerac... 148 1e-35
sp|Q43270|PLDA1_MAIZE Phospholipase D alpha 1 OS=Zea mays GN=PLD... 148 1e-35
sp|Q38882|PLDA1_ARATH Phospholipase D alpha 1 OS=Arabidopsis tha... 148 1e-35
sp|Q9SSQ9|PLDA2_ARATH Phospholipase D alpha 2 OS=Arabidopsis tha... 147 3e-35
sp|P93400|PLDA1_TOBAC Phospholipase D alpha 1 OS=Nicotiana tabac... 147 3e-35
sp|O04865|PLDA1_VIGUN Phospholipase D alpha 1 OS=Vigna unguicula... 145 7e-35
sp|Q41142|PLDA1_RICCO Phospholipase D alpha 1 OS=Ricinus communi... 144 2e-34
sp|Q43007|PLDA1_ORYSJ Phospholipase D alpha 1 OS=Oryza sativa su... 143 3e-34
sp|P93844|PLDA2_ORYSJ Phospholipase D alpha 2 OS=Oryza sativa su... 142 1e-33
sp|Q9C888|PLDE1_ARATH Phospholipase D epsilon OS=Arabidopsis tha... 127 2e-29
sp|Q9M9W8|PLDP2_ARATH Phospholipase D p2 OS=Arabidopsis thaliana... 64 4e-10
sp|Q9LRZ5|PLDP1_ARATH Phospholipase D p1 OS=Arabidopsis thaliana... 63 6e-10
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN... 59 1e-08
sp|Q09706|YA2G_SCHPO Uncharacterized protein C2F7.16c OS=Schizos... 53 6e-07
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE... 52 2e-06
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1... 52 2e-06
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE... 52 2e-06
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE... 52 2e-06
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=P... 52 2e-06
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE... 51 3e-06
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2... 51 3e-06

>sp|O23078|PLDB2_ARATH Phospholipase D beta 2 OS=Arabidopsis thaliana
GN=PLDBETA2 PE=2 SV=2
Length = 915

Score = 179 bits (455), Expect = 4e-45
Identities = 84/145 (57%), Positives = 114/145 (78%), Gaps = 1/145 (0%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPT-TPI 206
++IL++Q +TM+MM+ I +AL E G E ++ P D+LNFFCLGNRE+V + + T +
Sbjct: 687 QRILYWQHKTMQMMYGTIYNALVEAGLEDEYSPQDYLNFFCLGNREMVNGNNESGTGSAS 746

Query: 207 DDKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHR 386
++ +P L +KS RFMIYVH+KGM+VDDE+V++GSANINQRSM+G+RDTEIAMGAYQ
Sbjct: 747 NENTPQGLCRKSRRFMIYVHSKGMVVDDEYVVIGSANINQRSMEGTRDTEIAMGAYQPQH 806

Query: 387 TWANKGSHTHGQVYGFRMSLWAEHL 461
TWA + S GQ+YG+RMSLWAEH+
Sbjct: 807 TWARRQSGPRGQIYGYRMSLWAEHM 831


>sp|Q9C5Y0|PLDD1_ARATH Phospholipase D delta OS=Arabidopsis thaliana
GN=PLDDELTA PE=1 SV=2
Length = 868

Score = 176 bits (446), Expect = 5e-44
Identities = 86/144 (59%), Positives = 111/144 (77%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++IL++QSQTM+MM+ +IA L+ + D HP D+LNF+CLG RE +P+D P
Sbjct: 647 QEILYWQSQTMQMMYDVIAKELKAV--QSDAHPLDYLNFYCLGKREQLPDD-----MPAT 699

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
+ S ++ + RFMIYVHAKGMIVDDE+V++GSANINQRSM G++DTEIAMGAYQ + T
Sbjct: 700 NGSVVSDSYNFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHT 759

Query: 390 WANKGSHTHGQVYGFRMSLWAEHL 461
WA+KG H GQVYG+RMSLWAEHL
Sbjct: 760 WAHKGRHPRGQVYGYRMSLWAEHL 783


>sp|Q9T051|PLDG2_ARATH Phospholipase D gamma 2 OS=Arabidopsis thaliana
GN=PLDGAMMA2 PE=1 SV=3
Length = 856

Score = 175 bits (443), Expect = 1e-43
Identities = 87/152 (57%), Positives = 109/152 (71%), Gaps = 8/152 (5%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREV----VPEDG---- 185
++IL++Q +TM+MM+ I AL E G + P DFLNFFCLGNREV VP+
Sbjct: 621 QRILYWQHKTMQMMYQTIYKALLEVGLDGQLEPQDFLNFFCLGNREVGTREVPDGTVNVY 680

Query: 186 SAPTTPIDDKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAM 365
+ P P + A KS RFMIYVH+KGM+VDDEFV++GSANINQRS++G+RDTEIAM
Sbjct: 681 NCPRKPPQPNAAQVQALKSRRFMIYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAM 740

Query: 366 GAYQAHRTWANKGSHTHGQVYGFRMSLWAEHL 461
G YQ H +WA KGS GQ++G+RMSLWAEHL
Sbjct: 741 GGYQPHHSWAKKGSRPRGQIFGYRMSLWAEHL 772


>sp|Q9T053|PLDG1_ARATH Phospholipase D gamma 1 OS=Arabidopsis thaliana
GN=PLDGAMMA1 PE=2 SV=1
Length = 858

Score = 174 bits (441), Expect = 2e-43
Identities = 87/151 (57%), Positives = 107/151 (70%), Gaps = 7/151 (4%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++IL++Q +TM+MM+ I AL E G + P DFLNFFCLG REV S +P
Sbjct: 624 QRILYWQHKTMQMMYQTIYKALVEVGLDSQFEPQDFLNFFCLGTREVPVGTVSVYNSPRK 683

Query: 210 DKSPLALAQ-------KSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMG 368
P A A KS RFMIYVH+KGM+VDDEFV++GSANINQRS++G+RDTEIAMG
Sbjct: 684 PPQPNANANAAQVQALKSRRFMIYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAMG 743

Query: 369 AYQAHRTWANKGSHTHGQVYGFRMSLWAEHL 461
YQ H +WA KGS HGQ++G+RMSLWAEHL
Sbjct: 744 GYQPHYSWAMKGSRPHGQIFGYRMSLWAEHL 774


>sp|P93733|PLDB1_ARATH Phospholipase D beta 1 OS=Arabidopsis thaliana
GN=PLDBETA1 PE=2 SV=3
Length = 967

Score = 173 bits (438), Expect = 4e-43
Identities = 86/146 (58%), Positives = 112/146 (76%), Gaps = 2/146 (1%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPE-DGSAPTTPI 206
++IL++Q +T++MM+ I AL ETG E P D+LNFFCLGNRE+V D S +P
Sbjct: 738 QRILYWQHKTIQMMYETIYKALVETGLEGAFSPQDYLNFFCLGNREMVDGIDNSGTGSPR 797

Query: 207 DDKSPLA-LAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAH 383
++ L L++KS RFM+YVH+KGM+VDDE+V++GSANINQRSM+G+RDTEIAMGAYQ
Sbjct: 798 QMQTLLRPLSRKSRRFMVYVHSKGMVVDDEYVVIGSANINQRSMEGTRDTEIAMGAYQPQ 857

Query: 384 RTWANKGSHTHGQVYGFRMSLWAEHL 461
TWA K S GQ+YG+RMSLWAEH+
Sbjct: 858 HTWARKHSGPRGQIYGYRMSLWAEHM 883


>sp|Q9T052|PLDG3_ARATH Phospholipase D gamma 3 OS=Arabidopsis thaliana
GN=PLDGAMMA3 PE=2 SV=1
Length = 866

Score = 171 bits (434), Expect = 1e-42
Identities = 86/152 (56%), Positives = 109/152 (71%), Gaps = 8/152 (5%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREV----VPEDG---- 185
++IL++Q +TM+MM+ I AL E G + P DFLNFFCLG REV VP+
Sbjct: 631 QRILYWQHKTMQMMYQTIYKALVEVGLDGQLEPQDFLNFFCLGTREVGTREVPDGTVSVY 690

Query: 186 SAPTTPIDDKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAM 365
++P P + A KS RFMIYVH+KGM+VDDEFV++GSANINQRS++G+RDTEIAM
Sbjct: 691 NSPRKPPQLNAAQVQALKSRRFMIYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAM 750

Query: 366 GAYQAHRTWANKGSHTHGQVYGFRMSLWAEHL 461
G YQ H +WA KGS GQ++G+RMSLWAEHL
Sbjct: 751 GGYQPHHSWAKKGSRPRGQIFGYRMSLWAEHL 782


>sp|O04883|PLDA1_PIMBR Phospholipase D alpha 1 OS=Pimpinella
brachycarpa GN=PLD1 PE=2 SV=1
Length = 808

Score = 151 bits (381), Expect = 2e-36
Identities = 80/142 (56%), Positives = 102/142 (71%)
Frame = +3

Query: 36 ILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPIDDK 215
IL +Q +TMEMM+ I AL+ G E+D P ++L FFCLGNREV + P+ D
Sbjct: 585 ILDWQRRTMEMMYKDIIQALQANGIEED--PRNYLTFFCLGNREVKRDGEYEPSEKPDPD 642

Query: 216 SPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRTWA 395
+ + AQ+S RFMIYVHAK MIVDDE++I+GSANINQRSMDG++D+EIAMGAYQ H
Sbjct: 643 TDYSRAQESRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGAKDSEIAMGAYQPHHLAT 702

Query: 396 NKGSHTHGQVYGFRMSLWAEHL 461
+ + GQ++GFRMSLW EHL
Sbjct: 703 REPA--RGQIHGFRMSLWYEHL 722


>sp|P58766|PLDZ1_ARATH Phospholipase D zeta OS=Arabidopsis thaliana
GN=PLDZETA PE=2 SV=1
Length = 820

Score = 150 bits (379), Expect = 3e-36
Identities = 81/143 (56%), Positives = 97/143 (67%)
Frame = +3

Query: 36 ILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPIDDK 215
IL +Q +TMEMM+T I ALR+ G D +P D+L FFCLGNRE P +
Sbjct: 593 ILDWQRRTMEMMYTDIIIALRKKGL--DANPRDYLTFFCLGNREKGKVGEYLPPEKPEAN 650

Query: 216 SPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRTWA 395
S A AQ+S RFMIYVH+K MIVDDE++I+GSANINQRSMDG RDTEIAMGAYQ +
Sbjct: 651 SDYARAQESRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDTEIAMGAYQPSHLLS 710

Query: 396 NKGSHTHGQVYGFRMSLWAEHLR 464
GQ++ FR+SLW EHLR
Sbjct: 711 TNNMRPVGQIFSFRISLWLEHLR 733


>sp|O82549|PLDA1_BRAOC Phospholipase D alpha 1 OS=Brassica oleracea
var. capitata GN=PLD1 PE=2 SV=1
Length = 810

Score = 149 bits (376), Expect = 6e-36
Identities = 80/142 (56%), Positives = 97/142 (68%)
Frame = +3

Query: 36 ILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPIDDK 215
IL +Q +TM+MM+ I ALR G E+D P ++L FFCLGNREV E P D
Sbjct: 587 ILDWQRRTMQMMYKDIVQALRAQGLEED--PRNYLTFFCLGNREVKKEGEYEPAERPDAD 644

Query: 216 SPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRTWA 395
S AQ++ RFMIYVH K MIVDDE++I+GSANINQRSMDG+RD+EIAMG YQ H
Sbjct: 645 SSYMKAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHH--L 702

Query: 396 NKGSHTHGQVYGFRMSLWAEHL 461
+ GQ++GFRMSLW EHL
Sbjct: 703 SHRQPARGQIHGFRMSLWYEHL 724


>sp|P55939|PLDA2_BRAOC Phospholipase D alpha 2 OS=Brassica oleracea
var. capitata GN=PLD2 PE=1 SV=2
Length = 812

Score = 148 bits (374), Expect = 1e-35
Identities = 79/142 (55%), Positives = 98/142 (69%)
Frame = +3

Query: 36 ILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPIDDK 215
IL +Q +T+EMM+ + ALR G E+D P ++L FFCLGNREV E P D
Sbjct: 589 ILDWQRRTLEMMYKDVTQALRAQGLEED--PRNYLTFFCLGNREVKKEGEYEPAERPDPD 646

Query: 216 SPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRTWA 395
+ AQ++ RFMIYVH+K MIVDDE++I+GSANINQRSMDG+RD+EIAMG YQ H
Sbjct: 647 TDYMRAQEARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHH--L 704

Query: 396 NKGSHTHGQVYGFRMSLWAEHL 461
+ GQV+GFRMSLW EHL
Sbjct: 705 SHRQPARGQVHGFRMSLWYEHL 726


tr_hit_id B4FLG2
Definition tr|B4FLG2|B4FLG2_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 144
Score (bit) 203.0
E-value 4.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914530|Adiantum capillus-veneris mRNA, clone:
YMU001_000059_H08.
(473 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4FLG2|B4FLG2_MAIZE Putative uncharacterized protein OS=Zea m... 203 4e-51
tr|B8LQ49|B8LQ49_PICSI Putative uncharacterized protein OS=Picea... 199 7e-50
tr|A7QCN7|A7QCN7_VITVI Chromosome chr12 scaffold_78, whole genom... 194 1e-48
tr|A5AK90|A5AK90_VITVI Putative uncharacterized protein OS=Vitis... 194 1e-48
tr|A9TUD0|A9TUD0_PHYPA Predicted protein OS=Physcomitrella paten... 191 2e-47
tr|B8BE27|B8BE27_ORYSI Putative uncharacterized protein OS=Oryza... 190 3e-47
tr|A7QKD5|A7QKD5_VITVI Chromosome chr2 scaffold_112, whole genom... 190 3e-47
tr|Q8H1T6|Q8H1T6_TOBAC Phospholipase D beta 1 isoform (Fragment)... 187 2e-46
tr|A9RYM7|A9RYM7_PHYPA Predicted protein OS=Physcomitrella paten... 187 2e-46
tr|A7NVP6|A7NVP6_VITVI Chromosome chr18 scaffold_1, whole genome... 184 1e-45
tr|Q9AWB7|Q9AWB7_SOLLC Phospholipase PLDb1 OS=Solanum lycopersic... 184 2e-45
tr|Q0IZX5|Q0IZX5_ORYSJ Os09g0543100 protein OS=Oryza sativa subs... 183 4e-45
tr|A9T4Z0|A9T4Z0_PHYPA Predicted protein OS=Physcomitrella paten... 183 4e-45
tr|A7R1R6|A7R1R6_VITVI Chromosome chr4 scaffold_373, whole genom... 183 4e-45
tr|Q8SAG4|Q8SAG4_ORYSA Phospholipase D nu-2 (Fragment) OS=Oryza ... 182 6e-45
tr|Q8LGW5|Q8LGW5_ORYSJ Os07g0260400 protein OS=Oryza sativa subs... 182 6e-45
tr|B8B515|B8B515_ORYSI Putative uncharacterized protein OS=Oryza... 182 6e-45
tr|A9RNX2|A9RNX2_PHYPA Predicted protein OS=Physcomitrella paten... 182 6e-45
tr|A7PY70|A7PY70_VITVI Chromosome chr15 scaffold_37, whole genom... 182 6e-45
tr|Q9AWB6|Q9AWB6_SOLLC Phospholipase PLDb2 OS=Solanum lycopersic... 182 7e-45
tr|Q9LKM1|Q9LKM1_ORYSI Phospholipase D OS=Oryza sativa subsp. in... 177 2e-43
tr|Q6AVR2|Q6AVR2_ORYSJ Phospholipase D (Phospholipase D gamma 3,... 177 2e-43
tr|Q10AU7|Q10AU7_ORYSJ Os03g0840800 protein OS=Oryza sativa subs... 177 2e-43
tr|B8AN68|B8AN68_ORYSI Putative uncharacterized protein OS=Oryza... 177 2e-43
tr|A3APK7|A3APK7_ORYSJ Putative uncharacterized protein OS=Oryza... 177 2e-43
tr|Q8L891|Q8L891_ARATH AT4g35790/F4B14_60 OS=Arabidopsis thalian... 176 5e-43
tr|Q9XGT0|Q9XGT0_GOSHI Phospholipase D OS=Gossypium hirsutum GN=... 176 7e-43
tr|Q8H6B8|Q8H6B8_GOSHI Phospholipase D beta 1 isoform 1b-2 (Frag... 176 7e-43
tr|B8ALW4|B8ALW4_ORYSI Putative uncharacterized protein OS=Oryza... 175 9e-43
tr|Q8SAG7|Q8SAG7_ORYSA Phospholipase D beta 2 OS=Oryza sativa GN... 175 1e-42

>tr|B4FLG2|B4FLG2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 239

Score = 203 bits (516), Expect = 4e-51
Identities = 100/144 (69%), Positives = 113/144 (78%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILFFQ+QTMEMM+ +IAD L+ T KD HP D+LNFFCLGNRE P +GS +
Sbjct: 13 QEILFFQAQTMEMMYKIIADELKATDN-KDMHPEDYLNFFCLGNREEPPSNGSPESEKST 71

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
DKS ALA K RFMIYVHAKGMIVDDE+VILGSANINQRS+ GSRDTEIAMGAYQ H
Sbjct: 72 DKSAAALASKYRRFMIYVHAKGMIVDDEYVILGSANINQRSLAGSRDTEIAMGAYQPHYA 131

Query: 390 WANKGSHTHGQVYGFRMSLWAEHL 461
W+ K H HGQVYG+R SLWAEHL
Sbjct: 132 WSTKNGHPHGQVYGYRTSLWAEHL 155


>tr|B8LQ49|B8LQ49_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 861

Score = 199 bits (505), Expect = 7e-50
Identities = 97/146 (66%), Positives = 115/146 (78%), Gaps = 2/146 (1%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAP--TTP 203
++ILF+QSQTMEMM+ +IA+AL++ G HP D+LNF+CLGNRE P+DG P T
Sbjct: 634 QEILFWQSQTMEMMYGIIAEALKDAGLADSQHPQDYLNFYCLGNRE--PKDGREPPPTNS 691

Query: 204 IDDKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAH 383
+ SP AQK RFMIYVHAKGMIVDDE+VI+GSANIN+RS+DGSRDTEIAMG+YQ H
Sbjct: 692 PAENSPQGQAQKFRRFMIYVHAKGMIVDDEYVIMGSANINERSLDGSRDTEIAMGSYQPH 751

Query: 384 RTWANKGSHTHGQVYGFRMSLWAEHL 461
TW K H HGQVYG+RMSLWAEHL
Sbjct: 752 HTWDRKQRHPHGQVYGYRMSLWAEHL 777


>tr|A7QCN7|A7QCN7_VITVI Chromosome chr12 scaffold_78, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035483001
PE=4 SV=1
Length = 856

Score = 194 bits (494), Expect(2) = 1e-48
Identities = 91/144 (63%), Positives = 110/144 (76%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILF+Q QTM MM+ +I A+ + G HHP D+LNF+CLG RE + SA T+
Sbjct: 629 QEILFWQGQTMSMMYQIIGQAIHKAGLSDTHHPQDYLNFYCLGKREASSTESSAQTSNSS 688

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
+ L LAQK RFMIYVHAKGMIVDDE+V++GSANINQRS+DGSRDTEIAMGAYQ T
Sbjct: 689 ENRALGLAQKFRRFMIYVHAKGMIVDDEYVLIGSANINQRSLDGSRDTEIAMGAYQPSYT 748

Query: 390 WANKGSHTHGQVYGFRMSLWAEHL 461
W+ K +H HGQVYG+RMSLWAEHL
Sbjct: 749 WSGKKTHPHGQVYGYRMSLWAEHL 772



Score = 22.3 bits (46), Expect(2) = 1e-48
Identities = 9/11 (81%), Positives = 10/11 (90%)
Frame = +2

Query: 2 EGVPTSTSMQE 34
EGVPTS S+QE
Sbjct: 620 EGVPTSASVQE 630


>tr|A5AK90|A5AK90_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029215 PE=4 SV=1
Length = 565

Score = 194 bits (494), Expect(2) = 1e-48
Identities = 91/144 (63%), Positives = 110/144 (76%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILF+Q QTM MM+ +I A+ + G HHP D+LNF+CLG RE + SA T+
Sbjct: 338 QEILFWQGQTMSMMYQIIGQAINKAGLSDTHHPQDYLNFYCLGKREASSTESSAQTSNSS 397

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
+ L LAQK RFMIYVHAKGMIVDDE+V++GSANINQRS+DGSRDTEIAMGAYQ T
Sbjct: 398 ENRALGLAQKFRRFMIYVHAKGMIVDDEYVLIGSANINQRSLDGSRDTEIAMGAYQPSYT 457

Query: 390 WANKGSHTHGQVYGFRMSLWAEHL 461
W+ K +H HGQVYG+RMSLWAEHL
Sbjct: 458 WSGKKTHPHGQVYGYRMSLWAEHL 481



Score = 22.3 bits (46), Expect(2) = 1e-48
Identities = 9/11 (81%), Positives = 10/11 (90%)
Frame = +2

Query: 2 EGVPTSTSMQE 34
EGVPTS S+QE
Sbjct: 329 EGVPTSASVQE 339


>tr|A9TUD0|A9TUD0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_198384 PE=4 SV=1
Length = 813

Score = 191 bits (484), Expect = 2e-47
Identities = 92/144 (63%), Positives = 111/144 (77%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILFFQSQT++MM+ +IA+ +R+TG + PTD+LNF+CLGNRE +AP P +
Sbjct: 585 QEILFFQSQTIKMMYAIIAETIRDTGLDTQVKPTDYLNFYCLGNRETKKPGEAAPLNPPE 644

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
KS A +Q S R MIYVHAKG+IVDDE VI+GSANINQRSMDGSRDTEIAMG YQ T
Sbjct: 645 PKSRHAQSQDSRRMMIYVHAKGIIVDDELVIMGSANINQRSMDGSRDTEIAMGGYQPRHT 704

Query: 390 WANKGSHTHGQVYGFRMSLWAEHL 461
WA+K GQVYG+RMSLWAEHL
Sbjct: 705 WAHKNGPPRGQVYGYRMSLWAEHL 728


>tr|B8BE27|B8BE27_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_32238 PE=4 SV=1
Length = 846

Score = 190 bits (483), Expect = 3e-47
Identities = 95/144 (65%), Positives = 112/144 (77%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILFFQ+QTMEMM+ +IA L+ K+ HP D+LNF+CLGNRE +P + +
Sbjct: 622 QEILFFQAQTMEMMYRIIAQELKAMNI-KNAHPQDYLNFYCLGNREESSSSNGSPES--N 678

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
DKS ALA+K RFMIYVHAKGMIVDDE+VILGSANINQRS+ GSRDTEIAMGAYQ H T
Sbjct: 679 DKSAAALARKYRRFMIYVHAKGMIVDDEYVILGSANINQRSLAGSRDTEIAMGAYQPHHT 738

Query: 390 WANKGSHTHGQVYGFRMSLWAEHL 461
W+ KG H GQVYG+R SLWAEHL
Sbjct: 739 WSTKGGHPRGQVYGYRTSLWAEHL 762


>tr|A7QKD5|A7QKD5_VITVI Chromosome chr2 scaffold_112, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001073001
PE=4 SV=1
Length = 839

Score = 190 bits (482), Expect = 3e-47
Identities = 90/143 (62%), Positives = 114/143 (79%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILF+Q +TM+MM+ ++ AL+E G E +HP D+LNFFCLGNRE + +A
Sbjct: 613 QRILFWQHKTMQMMYEMVYKALQEVGLENQYHPQDYLNFFCLGNREEGVDTSNAGNQSAA 672

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
+ +P ALA+KS RFMIYVH+KGMIVDDE++I+GSANINQRSM+G+RDTEIAMGAYQ H T
Sbjct: 673 N-TPQALARKSRRFMIYVHSKGMIVDDEYLIIGSANINQRSMEGTRDTEIAMGAYQPHHT 731

Query: 390 WANKGSHTHGQVYGFRMSLWAEH 458
WA K S HGQ+YG+RMSLWAEH
Sbjct: 732 WARKQSSPHGQIYGYRMSLWAEH 754


>tr|Q8H1T6|Q8H1T6_TOBAC Phospholipase D beta 1 isoform (Fragment)
OS=Nicotiana tabacum PE=2 SV=1
Length = 579

Score = 187 bits (476), Expect = 2e-46
Identities = 90/143 (62%), Positives = 108/143 (75%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILF+Q TM+MM+ I AL E G E + P D+LNFFCLGNREV + +
Sbjct: 366 QRILFWQHNTMQMMYETIYKALVEVGLENTYEPQDYLNFFCLGNREVQEDGNNTVVKSSK 425

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
+P L+QKS RFMIYVH+KGMIVDDE+VILGSANINQRS++G+RDTEIAMG+YQ H T
Sbjct: 426 PTTPQELSQKSRRFMIYVHSKGMIVDDEYVILGSANINQRSLEGTRDTEIAMGSYQPHHT 485

Query: 390 WANKGSHTHGQVYGFRMSLWAEH 458
WA K S HGQVYG+RMSLWAEH
Sbjct: 486 WATKHSRPHGQVYGYRMSLWAEH 508


>tr|A9RYM7|A9RYM7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_105451 PE=4 SV=1
Length = 844

Score = 187 bits (475), Expect = 2e-46
Identities = 92/147 (62%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILFFQ+QT++MM+ +IADALR+ GK + HP D+LNF+CLGNRE E + P
Sbjct: 613 QEILFFQAQTIKMMYGVIADALRDVGKLGELHPRDYLNFYCLGNRETKSEVEAKADPPAK 672

Query: 210 DKSPLAL---AQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQA 380
+P AQK RFMIYVHAKGM+VDDE++I GSANINQRSMDGSRDTEIAMGA+Q
Sbjct: 673 APAPETKHGQAQKHRRFMIYVHAKGMVVDDEYIICGSANINQRSMDGSRDTEIAMGAFQP 732

Query: 381 HRTWANKGSHTHGQVYGFRMSLWAEHL 461
TWA+ G H GQVYG+RMSLW+EHL
Sbjct: 733 RYTWAHNGGHPMGQVYGYRMSLWSEHL 759


>tr|A7NVP6|A7NVP6_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015517001
PE=4 SV=1
Length = 510

Score = 184 bits (468), Expect = 1e-45
Identities = 92/144 (63%), Positives = 111/144 (77%)
Frame = +3

Query: 30 RKILFFQSQTMEMMFTLIADALRETGKEKDHHPTDFLNFFCLGNREVVPEDGSAPTTPID 209
++ILF+Q QTM+MM+ +IA L+ E D HP D+LNF+CLGNRE P++ S+ T
Sbjct: 286 QEILFWQGQTMQMMYDIIAQELQSMQLE-DAHPQDYLNFYCLGNREEPPKEVSSSNTQAS 344

Query: 210 DKSPLALAQKSGRFMIYVHAKGMIVDDEFVILGSANINQRSMDGSRDTEIAMGAYQAHRT 389
D ++ ++K RFMIYVHAKGMIVDDE+VILGSANINQRSM GSRDTEIAMGAYQ T
Sbjct: 345 DG--VSTSKKFHRFMIYVHAKGMIVDDEYVILGSANINQRSMAGSRDTEIAMGAYQPRHT 402

Query: 390 WANKGSHTHGQVYGFRMSLWAEHL 461
WA K H HGQ+YG+RMSLWAEHL
Sbjct: 403 WAKKKKHPHGQIYGYRMSLWAEHL 426