BP914539
Clone id YMU001_000060_A09
Library
Length 537
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000060_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCGACAGAACCTATTGCTGTCGAGCCTGAGGTTGCACGAGAAGTGAAGCAGAAGCTGG
AGTTAGGAGCAGTGAAATTCGAGGCTTTACGTGATCGGGAGCTACCAACCATGAAGGGCT
TGGGAAGTCTGGAAAGGCGAATCTTGGATGTTAACAAGAAGAGGTTCAAAGTTGTCAAGC
CAGGATCGAAAACCTCCTTTCCCAACACTGAGATTCGGGGCACTTATTCCCCTCCTTTCC
ATGTGGACATCATTCAGAATGATCAACATCGGTTGAAAATAGTTGTTGAGAGTGAAAATG
AGGTTGATTTGATGGTTCAAACAAGACATATACGGGATGTGATCGTGCTTGTATTGAGAG
GATTTGCATTGCGCTTCAATGCACTTTCTCTGCCTACATTGTTGAAACCCTAATGTCCAC
TTCTTTTGTGAGTTACAAAATAGGTCAATTTTGTAATTTACAAGTAGTGTTGTATTCATT
GCAGCACTATGGTGTCTTTCGTGCTGCAGTTGTTTATTTGGAATATTTCGAAAAAAA
■■Homology search results ■■ -
sp_hit_id P20073
Definition sp|P20073|ANXA7_HUMAN Annexin A7 OS=Homo sapiens
Align length 66
Score (bit) 34.3
E-value 0.39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914539|Adiantum capillus-veneris mRNA, clone:
YMU001_000060_A09.
(537 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P20073|ANXA7_HUMAN Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3 34 0.39
sp|Q553U6|ACT22_DICDI Putative actin-22 OS=Dictyostelium discoid... 33 1.1
sp|A6TR78|MUTL_ALKMQ DNA mismatch repair protein mutL OS=Alkalip... 31 3.3
sp|P07829|ACT3_DICDI Actin-3 OS=Dictyostelium discoideum GN=act3... 31 3.3
sp|Q7YR31|RNF39_PANTR RING finger protein 39 OS=Pan troglodytes ... 30 5.7
sp|P51961|RISA_PHOPO Riboflavin synthase alpha chain OS=Photobac... 30 5.7
sp|Q97ZH6|GATE_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit... 30 5.7
sp|P07830|ACT1_DICDI Major actin OS=Dictyostelium discoideum GN=... 30 5.7
sp|Q54GX7|ACT10_DICDI Actin-10 OS=Dictyostelium discoideum GN=ac... 30 5.7
sp|Q5TM52|RNF39_MACMU RING finger protein 39 OS=Macaca mulatta G... 30 7.4
sp|Q8TZ12|GATE_METKA Glutamyl-tRNA(Gln) amidotransferase subunit... 30 7.4
sp|Q4R731|CL050_MACFA Uncharacterized protein C12orf50 homolog O... 30 7.4
sp|Q8NA57|CL050_HUMAN Uncharacterized protein C12orf50 OS=Homo s... 30 7.4
sp|P57511|RF2_BUCAI Peptide chain release factor 2 OS=Buchnera a... 30 9.7
sp|Q971W7|GATE_SULTO Glutamyl-tRNA(Gln) amidotransferase subunit... 30 9.7

>sp|P20073|ANXA7_HUMAN Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3
Length = 488

Score = 34.3 bits (77), Expect = 0.39
Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 7/66 (10%)
Frame = +3

Query: 24 EPEVAREVKQKLELGAVKFEALRDREL--PTMKGLGSLERRILDV-----NKKRFKVVKP 182
EP +V Q A F+A+RD E+ MKG G+ E+ I+DV N +R K +K
Sbjct: 167 EPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQK-IKA 225

Query: 183 GSKTSF 200
KTS+
Sbjct: 226 AFKTSY 231


>sp|Q553U6|ACT22_DICDI Putative actin-22 OS=Dictyostelium discoideum
GN=act22 PE=3 SV=1
Length = 376

Score = 32.7 bits (73), Expect = 1.1
Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 7/80 (8%)
Frame = +3

Query: 24 EPEVAREVKQKLELGAVKFEALRDRELPTMKGLGSLER-------RILDVNKKRFKVVKP 182
E E+ R++K+KL A+ FEA E+ T SLE+ +++ + +RF+ +
Sbjct: 206 EREIVRDIKEKLAYVALDFEA----EMQTAASSSSLEKSYELPDGQVITIGNERFRCPEA 261

Query: 183 GSKTSFPNTEIRGTYSPPFH 242
+ SF E G + F+
Sbjct: 262 LFQPSFLGMESAGIHETTFN 281


>sp|A6TR78|MUTL_ALKMQ DNA mismatch repair protein mutL
OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutL
PE=3 SV=1
Length = 637

Score = 31.2 bits (69), Expect = 3.3
Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 4/124 (3%)
Frame = -2

Query: 524 IPNKQLQHERHHSAAMNTTLLVNYKIDLFCNSQKKWTLGFQQCRQRKCIEAQCK----SS 357
IP+ + QH++HH +N + N Q K ++G +Q + + Q K +S
Sbjct: 338 IPSTKNQHQQHHHLKE-----INLSQE---NIQSKESIGVKQQDKVMVADEQEKVKEYNS 389

Query: 356 QYKHDHIPYMSCLNHQINLIFTLNNYFQPMLIILNDVHMERRGISAPNLSVGKGGFRSWL 177
QY D P + +N + T + II N++ +E RGI N + K +++L
Sbjct: 390 QYVMDSRPKVQ-PPPMVNTLKTEDTQLNVASIISNELPVESRGIRT-NPQLQKNFIKTYL 447

Query: 176 DNFE 165
N++
Sbjct: 448 QNYK 451


>sp|P07829|ACT3_DICDI Actin-3 OS=Dictyostelium discoideum GN=act3
PE=3 SV=3
Length = 376

Score = 31.2 bits (69), Expect = 3.3
Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 7/80 (8%)
Frame = +3

Query: 24 EPEVAREVKQKLELGAVKFEALRDRELPTMKGLGSLER-------RILDVNKKRFKVVKP 182
E E+ R++K+KL A+ FEA EL T +LE+ +++ + +RF+ +
Sbjct: 206 EREIVRDIKEKLAYVALDFEA----ELQTAASSSALEKSYELPDGQVITIGNERFRCPEA 261

Query: 183 GSKTSFPNTEIRGTYSPPFH 242
+ SF E G + ++
Sbjct: 262 LFQPSFLGMESAGIHETTYN 281


>sp|Q7YR31|RNF39_PANTR RING finger protein 39 OS=Pan troglodytes
GN=RNF39 PE=3 SV=1
Length = 420

Score = 30.4 bits (67), Expect = 5.7
Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
Frame = +3

Query: 15 IAVEPEVAREVKQKLELGAVKFEALRDRELPTMKGLGSLERRILDVNK--KRFKVVKPGS 188
+AVE ++RE+++KL + R +PTM G L+ D+ K +RF+V P S
Sbjct: 149 LAVEVRISRELREKLAEPGARAGRRRGGRIPTM---GCLDLPGEDMRKTWRRFEVPTPKS 205

Query: 189 KTSFPNTEIRGTYSPPFHVDIIQNDQHRL 275
S + P +++N HRL
Sbjct: 206 SNSEDDL--------PEDYPVVKNMLHRL 226


>sp|P51961|RISA_PHOPO Riboflavin synthase alpha chain
OS=Photobacterium phosphoreum GN=ribE PE=3 SV=1
Length = 218

Score = 30.4 bits (67), Expect = 5.7
Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
Frame = +2

Query: 341 DRACIERICIAL-QCTFSAYI----VETLMSTSFVSYKIGQFCNLQVVLYSLQHYG 493
D IC+ + + T ++Y+ +ETL T+F YK+GQ NL+ + +G
Sbjct: 40 DSIATNGICLTVVKLTANSYVADLSIETLSRTAFNYYKVGQAVNLEKAMLPTTRFG 95


>sp|Q97ZH6|GATE_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit E
OS=Sulfolobus solfataricus GN=gatE PE=3 SV=1
Length = 633

Score = 30.4 bits (67), Expect = 5.7
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = +3

Query: 81 EALRDRELPTMKGLGSLERRILDVNKKRFKVVKPGSKTSFPNTEIRGTYSPPFHVD 248
E ++DR L G+ R LD +F +PGS +P T+I PP +D
Sbjct: 394 EVIKDRILLAFDGIPKETRGALDDGTTKFLRPQPGSARMYPETDI-----PPRRID 444


>sp|P07830|ACT1_DICDI Major actin OS=Dictyostelium discoideum
GN=act1 PE=1 SV=2
Length = 376

Score = 30.4 bits (67), Expect = 5.7
Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 7/80 (8%)
Frame = +3

Query: 24 EPEVAREVKQKLELGAVKFEALRDRELPTMKGLGSLER-------RILDVNKKRFKVVKP 182
E E+ R++K+KL A+ FEA E+ T +LE+ +++ + +RF+ +
Sbjct: 206 EREIVRDIKEKLAYVALDFEA----EMQTAASSSALEKSYELPDGQVITIGNERFRCPEA 261

Query: 183 GSKTSFPNTEIRGTYSPPFH 242
+ SF E G + ++
Sbjct: 262 LFQPSFLGMESAGIHETTYN 281


>sp|Q54GX7|ACT10_DICDI Actin-10 OS=Dictyostelium discoideum GN=act10
PE=3 SV=1
Length = 376

Score = 30.4 bits (67), Expect = 5.7
Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 7/80 (8%)
Frame = +3

Query: 24 EPEVAREVKQKLELGAVKFEALRDRELPTMKGLGSLER-------RILDVNKKRFKVVKP 182
E E+ R++K+KL A+ FEA E+ T +LE+ +++ + +RF+ +
Sbjct: 206 EREIVRDIKEKLAYVALDFEA----EMQTAASSSALEKSYELPDGQVITIGNERFRCPEA 261

Query: 183 GSKTSFPNTEIRGTYSPPFH 242
+ SF E G + ++
Sbjct: 262 LFQPSFLGMESAGIHETTYN 281


>sp|Q5TM52|RNF39_MACMU RING finger protein 39 OS=Macaca mulatta
GN=RNF39 PE=3 SV=1
Length = 420

Score = 30.0 bits (66), Expect = 7.4
Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
Frame = +3

Query: 15 IAVEPEVAREVKQKLELGAVKFEALRDRELPTMKGLGSLERRILDVNK--KRFKVVKPGS 188
+AVE ++RE+++KL + R +PTM G L+ D+ K +RF+V P S
Sbjct: 149 LAVEVRISRELREKLAEPGARAGRRRGGRIPTM---GCLDPPGEDMRKTWRRFEVPTPKS 205

Query: 189 KTSFPNTEIRGTYSPPFHVDIIQNDQHRL 275
S + P +++N HRL
Sbjct: 206 SKSEDDL--------PEDYPVVKNMLHRL 226


tr_hit_id A9RYJ3
Definition tr|A9RYJ3|A9RYJ3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 132
Score (bit) 198.0
E-value 2.0e-49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914539|Adiantum capillus-veneris mRNA, clone:
YMU001_000060_A09.
(537 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RYJ3|A9RYJ3_PHYPA Predicted protein OS=Physcomitrella paten... 198 2e-49
tr|A7Q1D2|A7Q1D2_VITVI Chromosome chr10 scaffold_43, whole genom... 189 8e-47
tr|A9TP35|A9TP35_PHYPA Predicted protein OS=Physcomitrella paten... 187 2e-46
tr|Q69VA2|Q69VA2_ORYSJ Putative leucine rich repeat protein OS=O... 180 5e-44
tr|Q0D8L5|Q0D8L5_ORYSJ Os07g0148800 protein (Fragment) OS=Oryza ... 180 5e-44
tr|B8B7B1|B8B7B1_ORYSI Putative uncharacterized protein OS=Oryza... 180 5e-44
tr|A3BGK9|A3BGK9_ORYSJ Putative uncharacterized protein OS=Oryza... 180 5e-44
tr|Q0WPR3|Q0WPR3_ARATH Auxin-induced protein (Fragment) OS=Arabi... 175 1e-42
tr|Q00NU6|Q00NU6_ARATH AIR9 protein OS=Arabidopsis thaliana GN=A... 175 1e-42
tr|O82441|O82441_ARATH Putative uncharacterized protein AIR9 (Fr... 175 1e-42
tr|O64588|O64588_ARATH Putative uncharacterized protein At2g3468... 164 4e-39
tr|Q676X1|Q676X1_HYAOR LRR (Fragment) OS=Hyacinthus orientalis P... 147 4e-34
tr|A5AQ15|A5AQ15_VITVI Putative uncharacterized protein OS=Vitis... 47 6e-04
tr|Q7RSB9|Q7RSB9_PLAYO Putative uncharacterized protein PY00442 ... 35 1.9
tr|B4DHY4|B4DHY4_HUMAN cDNA FLJ55060, highly similar to Annexin ... 34 4.2
tr|B2R657|B2R657_HUMAN cDNA, FLJ92798, highly similar to Homo sa... 34 4.2
tr|A9VBY6|A9VBY6_MONBE Predicted protein OS=Monosiga brevicollis... 34 5.5
tr|Q6MYA5|Q6MYA5_ASPFU U4/u6 small nuclear ribonucleoprotein hpr... 34 5.5
tr|B0XRP2|B0XRP2_ASPFC U4/U6 small nuclear ribonucleoprotein, pu... 34 5.5
tr|A9SD83|A9SD83_PHYPA Predicted protein OS=Physcomitrella paten... 33 7.2
tr|Q4UAT4|Q4UAT4_THEAN Theileria-specific sub-telomeric protein,... 33 7.2
tr|Q23CU2|Q23CU2_TETTH Putative uncharacterized protein OS=Tetra... 33 7.2
tr|B7RNR4|B7RNR4_9RHOB Glycosyl transferase, WecB/TagA/CpsF fami... 33 9.3
tr|A9V8Z5|A9V8Z5_MONBE Predicted protein OS=Monosiga brevicollis... 33 9.3
tr|A2EQJ1|A2EQJ1_TRIVA Putative uncharacterized protein OS=Trich... 33 9.3
tr|Q53HM8|Q53HM8_HUMAN Annexin VII isoform 1 variant (Fragment) ... 33 9.3
tr|B4DWU2|B4DWU2_HUMAN cDNA FLJ54191, highly similar to Annexin ... 33 9.3
tr|B4DT77|B4DT77_HUMAN cDNA FLJ54149, highly similar to Annexin ... 33 9.3
tr|B2R7L2|B2R7L2_HUMAN cDNA, FLJ93494, highly similar to Homo sa... 33 9.3

>tr|A9RYJ3|A9RYJ3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_121394 PE=4 SV=1
Length = 1416

Score = 198 bits (503), Expect = 2e-49
Identities = 98/132 (74%), Positives = 116/132 (87%), Gaps = 5/132 (3%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMK-----GLGSLERRILDVNKKRF 167
ST+PI V+PEV++EVKQKLELG VKFEALRDR+ MK GLGSLERR+LDVNKKR
Sbjct: 1276 STDPIIVDPEVSKEVKQKLELGVVKFEALRDRDRSPMKSQNQQGLGSLERRVLDVNKKRV 1335

Query: 168 KVVKPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIV 347
KVVKPGSKT F + E+RGTY+PPFHV++ +NDQHRLKIV++SENEVDLMVQ+RHIRDVIV
Sbjct: 1336 KVVKPGSKTHFASNELRGTYTPPFHVEVFRNDQHRLKIVMDSENEVDLMVQSRHIRDVIV 1395

Query: 348 LVLRGFALRFNA 383
LV+RGF+ RFN+
Sbjct: 1396 LVIRGFSQRFNS 1407


>tr|A7Q1D2|A7Q1D2_VITVI Chromosome chr10 scaffold_43, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028406001
PE=4 SV=1
Length = 1717

Score = 189 bits (480), Expect = 8e-47
Identities = 93/129 (72%), Positives = 114/129 (88%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMK--GLGSLERRILDVNKKRFKVV 176
ST+PIAVEP+V +EVKQKL+LG+VKFEAL D++ K G+GS ERRIL+VN+KR KVV
Sbjct: 1578 STDPIAVEPDVFKEVKQKLDLGSVKFEALCDKDRSPKKAPGVGSFERRILEVNRKRVKVV 1637

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSKTSFP TEIRG+Y+PPFHV++ +NDQHRL+IVV+SENEVDLMV +RH+RDVIVLV+
Sbjct: 1638 KPGSKTSFPTTEIRGSYAPPFHVELFRNDQHRLRIVVDSENEVDLMVHSRHLRDVIVLVI 1697

Query: 357 RGFALRFNA 383
RG A RFN+
Sbjct: 1698 RGLAQRFNS 1706


>tr|A9TP35|A9TP35_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_148415 PE=4 SV=1
Length = 1635

Score = 187 bits (476), Expect = 2e-46
Identities = 91/132 (68%), Positives = 115/132 (87%), Gaps = 5/132 (3%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMK-----GLGSLERRILDVNKKRF 167
ST+PI V+PEV++EVK KLEL VKFEALRDR+ MK GLGSLERR+LDVN+KR
Sbjct: 1495 STDPIIVDPEVSKEVKLKLELAVVKFEALRDRDRSPMKSQNQQGLGSLERRVLDVNRKRV 1554

Query: 168 KVVKPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIV 347
KVVKPGSKT+F +TE+RG+Y+PPFHV++ +ND HR+KIV++SENEV+LMVQ+RHIRD+IV
Sbjct: 1555 KVVKPGSKTNFASTELRGSYAPPFHVEVFRNDPHRVKIVMDSENEVELMVQSRHIRDIIV 1614

Query: 348 LVLRGFALRFNA 383
LV+RGF+ RFN+
Sbjct: 1615 LVIRGFSQRFNS 1626


>tr|Q69VA2|Q69VA2_ORYSJ Putative leucine rich repeat protein OS=Oryza
sativa subsp. japonica GN=P0022E03.37 PE=4 SV=1
Length = 1689

Score = 180 bits (456), Expect = 5e-44
Identities = 88/129 (68%), Positives = 108/129 (83%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMKG--LGSLERRILDVNKKRFKVV 176
STEPIAVEPE+ +EVKQKL+ G+VKFE L D++ K +G LERRIL+VN+KR KVV
Sbjct: 1550 STEPIAVEPEIYKEVKQKLDDGSVKFEVLCDKDRTPKKAQVMGHLERRILEVNRKRIKVV 1609

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSK SFP TE+RGTY PPFHV++ +NDQHR KIVV+ E+EVDLMVQTRH+RDVI+LV+
Sbjct: 1610 KPGSKASFPTTEVRGTYVPPFHVELYRNDQHRFKIVVDGESEVDLMVQTRHMRDVIILVI 1669

Query: 357 RGFALRFNA 383
RG A +FN+
Sbjct: 1670 RGLAQKFNS 1678


>tr|Q0D8L5|Q0D8L5_ORYSJ Os07g0148800 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os07g0148800 PE=4 SV=1
Length = 376

Score = 180 bits (456), Expect = 5e-44
Identities = 88/129 (68%), Positives = 108/129 (83%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMKG--LGSLERRILDVNKKRFKVV 176
STEPIAVEPE+ +EVKQKL+ G+VKFE L D++ K +G LERRIL+VN+KR KVV
Sbjct: 237 STEPIAVEPEIYKEVKQKLDDGSVKFEVLCDKDRTPKKAQVMGHLERRILEVNRKRIKVV 296

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSK SFP TE+RGTY PPFHV++ +NDQHR KIVV+ E+EVDLMVQTRH+RDVI+LV+
Sbjct: 297 KPGSKASFPTTEVRGTYVPPFHVELYRNDQHRFKIVVDGESEVDLMVQTRHMRDVIILVI 356

Query: 357 RGFALRFNA 383
RG A +FN+
Sbjct: 357 RGLAQKFNS 365


>tr|B8B7B1|B8B7B1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24899 PE=4 SV=1
Length = 1679

Score = 180 bits (456), Expect = 5e-44
Identities = 88/129 (68%), Positives = 108/129 (83%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMKG--LGSLERRILDVNKKRFKVV 176
STEPIAVEPE+ +EVKQKL+ G+VKFE L D++ K +G LERRIL+VN+KR KVV
Sbjct: 1540 STEPIAVEPEIYKEVKQKLDDGSVKFEVLCDKDRTPKKAQVMGHLERRILEVNRKRIKVV 1599

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSK SFP TE+RGTY PPFHV++ +NDQHR KIVV+ E+EVDLMVQTRH+RDVI+LV+
Sbjct: 1600 KPGSKASFPTTEVRGTYVPPFHVELYRNDQHRFKIVVDGESEVDLMVQTRHMRDVIILVI 1659

Query: 357 RGFALRFNA 383
RG A +FN+
Sbjct: 1660 RGLAQKFNS 1668


>tr|A3BGK9|A3BGK9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_022181 PE=4 SV=1
Length = 1813

Score = 180 bits (456), Expect = 5e-44
Identities = 88/129 (68%), Positives = 108/129 (83%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMKG--LGSLERRILDVNKKRFKVV 176
STEPIAVEPE+ +EVKQKL+ G+VKFE L D++ K +G LERRIL+VN+KR KVV
Sbjct: 1674 STEPIAVEPEIYKEVKQKLDDGSVKFEVLCDKDRTPKKAQVMGHLERRILEVNRKRIKVV 1733

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSK SFP TE+RGTY PPFHV++ +NDQHR KIVV+ E+EVDLMVQTRH+RDVI+LV+
Sbjct: 1734 KPGSKASFPTTEVRGTYVPPFHVELYRNDQHRFKIVVDGESEVDLMVQTRHMRDVIILVI 1793

Query: 357 RGFALRFNA 383
RG A +FN+
Sbjct: 1794 RGLAQKFNS 1802


>tr|Q0WPR3|Q0WPR3_ARATH Auxin-induced protein (Fragment)
OS=Arabidopsis thaliana GN=At2g34680 PE=2 SV=1
Length = 947

Score = 175 bits (444), Expect = 1e-42
Identities = 85/129 (65%), Positives = 109/129 (84%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMK--GLGSLERRILDVNKKRFKVV 176
STEP+AVEP++ +EV+QKLE G VKFE L D++ K G G+LERR+L++N+KR KVV
Sbjct: 808 STEPVAVEPDILKEVRQKLETGLVKFEVLCDKDPYPKKIVGEGNLERRMLEMNRKRIKVV 867

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSKTSF TE+RG+Y PPFHV+ +NDQ RL+IVV+SENEVD++VQ+RH+RDVIVLV+
Sbjct: 868 KPGSKTSFATTEVRGSYGPPFHVETFRNDQRRLRIVVDSENEVDIVVQSRHLRDVIVLVI 927

Query: 357 RGFALRFNA 383
RGFA RFN+
Sbjct: 928 RGFAQRFNS 936


>tr|Q00NU6|Q00NU6_ARATH AIR9 protein OS=Arabidopsis thaliana GN=AIR9
PE=2 SV=1
Length = 1708

Score = 175 bits (444), Expect = 1e-42
Identities = 85/129 (65%), Positives = 109/129 (84%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMK--GLGSLERRILDVNKKRFKVV 176
STEP+AVEP++ +EV+QKLE G VKFE L D++ K G G+LERR+L++N+KR KVV
Sbjct: 1569 STEPVAVEPDILKEVRQKLETGLVKFEVLCDKDPYPKKIVGEGNLERRMLEMNRKRIKVV 1628

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSKTSF TE+RG+Y PPFHV+ +NDQ RL+IVV+SENEVD++VQ+RH+RDVIVLV+
Sbjct: 1629 KPGSKTSFATTEVRGSYGPPFHVETFRNDQRRLRIVVDSENEVDIVVQSRHLRDVIVLVI 1688

Query: 357 RGFALRFNA 383
RGFA RFN+
Sbjct: 1689 RGFAQRFNS 1697


>tr|O82441|O82441_ARATH Putative uncharacterized protein AIR9
(Fragment) OS=Arabidopsis thaliana GN=AIR9 PE=2 SV=1
Length = 234

Score = 175 bits (444), Expect = 1e-42
Identities = 85/129 (65%), Positives = 109/129 (84%), Gaps = 2/129 (1%)
Frame = +3

Query: 3 STEPIAVEPEVAREVKQKLELGAVKFEALRDRELPTMK--GLGSLERRILDVNKKRFKVV 176
STEP+AVEP++ +EV+QKLE G VKFE L D++ K G G+LERR+L++N+KR KVV
Sbjct: 92 STEPVAVEPDILKEVRQKLETGLVKFEVLCDKDPYPKKIVGEGNLERRMLEMNRKRIKVV 151

Query: 177 KPGSKTSFPNTEIRGTYSPPFHVDIIQNDQHRLKIVVESENEVDLMVQTRHIRDVIVLVL 356
KPGSKTSF TE+RG+Y PPFHV+ +NDQ RL+IVV+SENEVD++VQ+RH+RDVIVLV+
Sbjct: 152 KPGSKTSFATTEVRGSYGPPFHVETFRNDQRRLRIVVDSENEVDIVVQSRHLRDVIVLVI 211

Query: 357 RGFALRFNA 383
RGFA RFN+
Sbjct: 212 RGFAQRFNS 220