BP914627
Clone id YMU001_000061_B05
Library
Length 496
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000061_B05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCAGGTCTGCGGCTCGTACTTCTTCGCAATTTGTGACTCCGGCAAGCTCTGCGTTCCCTC
TCTAGAAGGTTTGCAGCATCAAGCTTGGATGTGGTGCTGCTAATGCTAAGCATAGGATTG
GCAGTTTATTTGAGGCAAATGGTGTAGCCTACTGGTGCTTCTACGATCTCTTGAGTCATG
AAATAGTTCTTACGTAAGGTAGAAACAGGTTTTCTTCATATTTCTCGCATCAATGGCGGA
ACCCAAAGATGACGAAAGAGATGAGGAATGGTTTAAGGAGGTTTATGGAAAAGAGTACAC
AGGACCCGTTAGGCCTGTCAGTGACAATGCTCGGGATAATTTGAGCACCAAGAAAAGGTC
AATGACAGAAGCAATTAGCAATGAACCTGATGAGGACGAGGCCCCTCCGGATCCTAATGC
TGTGCCCACTGATTTCACAAGTAGGGAAGCTAAAGTGTGGGAGGCGAATGCCAAAGCCAT
AGAAAGGAATTGGAAG
■■Homology search results ■■ -
sp_hit_id Q499Q5
Definition sp|Q499Q5|MKS1_RAT Meckel syndrome type 1 protein homolog OS=Rattus norvegicus
Align length 27
Score (bit) 30.8
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914627|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_B05.
(483 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q499Q5|MKS1_RAT Meckel syndrome type 1 protein homolog OS=Rat... 31 3.4
sp|Q5SW45|MKS1_MOUSE Meckel syndrome type 1 protein homolog OS=M... 31 3.4

>sp|Q499Q5|MKS1_RAT Meckel syndrome type 1 protein homolog OS=Rattus
norvegicus GN=Mks1 PE=2 SV=2
Length = 561

Score = 30.8 bits (68), Expect = 3.4
Identities = 12/27 (44%), Positives = 23/27 (85%), Gaps = 2/27 (7%)
Frame = +2

Query: 224 LASMAEPKDDERDEEWFKEVYG--KEY 298
++S+A+P+++ER++ FK++YG KEY
Sbjct: 271 VSSLAQPEEEEREQRVFKDLYGRHKEY 297


>sp|Q5SW45|MKS1_MOUSE Meckel syndrome type 1 protein homolog OS=Mus
musculus GN=Mks1 PE=2 SV=1
Length = 561

Score = 30.8 bits (68), Expect = 3.4
Identities = 12/27 (44%), Positives = 23/27 (85%), Gaps = 2/27 (7%)
Frame = +2

Query: 224 LASMAEPKDDERDEEWFKEVYG--KEY 298
++S+A+P+++ER++ FK++YG KEY
Sbjct: 271 VSSLAQPEEEEREQRVFKDLYGRHKEY 297


tr_hit_id A9TLA8
Definition tr|A9TLA8|A9TLA8_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 85
Score (bit) 73.9
E-value 4.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914627|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_B05.
(483 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TLA8|A9TLA8_PHYPA Predicted protein (Fragment) OS=Physcomit... 74 4e-12
tr|Q5NBC3|Q5NBC3_ORYSJ cDNA clone:001-114-C08, full insert seque... 66 7e-10
tr|A2ZRC4|A2ZRC4_ORYSJ Putative uncharacterized protein OS=Oryza... 66 7e-10
tr|A2WMY2|A2WMY2_ORYSI Putative uncharacterized protein OS=Oryza... 66 7e-10
tr|B6TIM5|B6TIM5_MAIZE Putative uncharacterized protein OS=Zea m... 64 5e-09
tr|B4FCC2|B4FCC2_MAIZE Putative uncharacterized protein OS=Zea m... 64 5e-09
tr|A7Q0Q5|A7Q0Q5_VITVI Chromosome chr7 scaffold_42, whole genome... 64 5e-09
tr|Q9LZQ7|Q9LZQ7_ARATH Putative uncharacterized protein T12C14_3... 52 2e-05
tr|B7FKP4|B7FKP4_MEDTR Putative uncharacterized protein OS=Medic... 42 0.012
tr|A8WKH1|A8WKH1_CAEBR Putative uncharacterized protein OS=Caeno... 33 7.0

>tr|A9TLA8|A9TLA8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_223358 PE=4 SV=1
Length = 197

Score = 73.9 bits (180), Expect = 4e-12
Identities = 41/85 (48%), Positives = 45/85 (52%), Gaps = 2/85 (2%)
Frame = +2

Query: 233 MAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNAR--DNLSTKKRSMTEAISXXXXXXXXX 406
MAE DD+RDEEWFKEVYG EYT P R R + K +
Sbjct: 1 MAEELDDDRDEEWFKEVYGTEYTAPARATGATRRAVEPAPPKVANKRAPNPSDSEEDEEQ 60

Query: 407 XXXXXVPTDFTSREAKVWEANAKAI 481
VPTDFTSREAKVWEA AKA+
Sbjct: 61 RDPTAVPTDFTSREAKVWEAKAKAV 85


>tr|Q5NBC3|Q5NBC3_ORYSJ cDNA clone:001-114-C08, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0434D08.42 PE=2 SV=1
Length = 275

Score = 66.2 bits (160), Expect = 7e-10
Identities = 37/82 (45%), Positives = 45/82 (54%)
Frame = +2

Query: 233 MAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTEAISXXXXXXXXXXX 412
MA E D+E F EVYGK Y+GPV ++N ++ +KR + S
Sbjct: 1 MAREPSPEIDDELFNEVYGKAYSGPVATTTNNVTPRVNDEKRPLEREKS---DEEDGPPD 57

Query: 413 XXXVPTDFTSREAKVWEANAKA 478
VPTDFTSREAKVWEA AKA
Sbjct: 58 PNAVPTDFTSREAKVWEAKAKA 79


>tr|A2ZRC4|A2ZRC4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001096 PE=4 SV=1
Length = 385

Score = 66.2 bits (160), Expect = 7e-10
Identities = 37/82 (45%), Positives = 45/82 (54%)
Frame = +2

Query: 233 MAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTEAISXXXXXXXXXXX 412
MA E D+E F EVYGK Y+GPV ++N ++ +KR + S
Sbjct: 1 MAREPSPEIDDELFNEVYGKAYSGPVATTTNNVTPRVNDEKRPLEREKS---DEEDGPPD 57

Query: 413 XXXVPTDFTSREAKVWEANAKA 478
VPTDFTSREAKVWEA AKA
Sbjct: 58 PNAVPTDFTSREAKVWEAKAKA 79


>tr|A2WMY2|A2WMY2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01205 PE=4 SV=1
Length = 106

Score = 66.2 bits (160), Expect = 7e-10
Identities = 37/82 (45%), Positives = 45/82 (54%)
Frame = +2

Query: 233 MAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTEAISXXXXXXXXXXX 412
MA E D+E F EVYGK Y+GPV ++N ++ +KR + S
Sbjct: 1 MAREPSPEIDDELFNEVYGKAYSGPVATTTNNVMPRVNDEKRPLEREKS---DEEDGPPD 57

Query: 413 XXXVPTDFTSREAKVWEANAKA 478
VPTDFTSREAKVWEA AKA
Sbjct: 58 PNAVPTDFTSREAKVWEAKAKA 79


>tr|B6TIM5|B6TIM5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 467

Score = 63.5 bits (153), Expect = 5e-09
Identities = 36/82 (43%), Positives = 45/82 (54%)
Frame = +2

Query: 233 MAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTEAISXXXXXXXXXXX 412
MA E D+E + EVYGK Y+GPV +++ + +KR +T S
Sbjct: 1 MAREPSPEIDDELYNEVYGKAYSGPVASATNSVTPKGNAEKRPLTRDKSDDEDEAPDPNA 60

Query: 413 XXXVPTDFTSREAKVWEANAKA 478
VPTDFTSREAKVWEA AKA
Sbjct: 61 ---VPTDFTSREAKVWEAKAKA 79


>tr|B4FCC2|B4FCC2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 467

Score = 63.5 bits (153), Expect = 5e-09
Identities = 36/82 (43%), Positives = 45/82 (54%)
Frame = +2

Query: 233 MAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTEAISXXXXXXXXXXX 412
MA E D+E + EVYGK Y+GPV +++ + +KR +T S
Sbjct: 1 MAREPSPEIDDELYNEVYGKAYSGPVASATNSVTPKGNAEKRPLTRDKSDDEDEAPDPNA 60

Query: 413 XXXVPTDFTSREAKVWEANAKA 478
VPTDFTSREAKVWEA AKA
Sbjct: 61 ---VPTDFTSREAKVWEAKAKA 79


>tr|A7Q0Q5|A7Q0Q5_VITVI Chromosome chr7 scaffold_42, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028140001
PE=4 SV=1
Length = 464

Score = 63.5 bits (153), Expect = 5e-09
Identities = 38/85 (44%), Positives = 45/85 (52%)
Frame = +2

Query: 224 LASMAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTEAISXXXXXXXX 403
+A EP DD+ F E+Y KEYTGP R + N +D T KRS +
Sbjct: 1 MAKRPEPDDDD-----FSEIY-KEYTGPPRSTTSNVQDKAKTSKRSHASS-----DEEEE 49

Query: 404 XXXXXXVPTDFTSREAKVWEANAKA 478
VPTDFTSREAKVWEA +KA
Sbjct: 50 PRDPNAVPTDFTSREAKVWEAKSKA 74


>tr|Q9LZQ7|Q9LZQ7_ARATH Putative uncharacterized protein T12C14_30
(At3g62330) OS=Arabidopsis thaliana GN=T12C14_30 PE=2
SV=1
Length = 479

Score = 51.6 bits (122), Expect = 2e-05
Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
Frame = +2

Query: 248 DDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTE-AISXXXXXXXXXXXXXXV 424
D E D++ F E+Y KEYTGP V++N N+ K + + + + V
Sbjct: 7 DPELDDD-FSEIY-KEYTGPASAVTNN---NIQDKDKPVKQRSEERCDEEEEQLPDPNSV 61

Query: 425 PTDFTSREAKVWEANAKA 478
PTDFTSREAKVWEA +KA
Sbjct: 62 PTDFTSREAKVWEAKSKA 79


>tr|B7FKP4|B7FKP4_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 361

Score = 42.4 bits (98), Expect = 0.012
Identities = 29/82 (35%), Positives = 43/82 (52%)
Frame = +2

Query: 233 MAEPKDDERDEEWFKEVYGKEYTGPVRPVSDNARDNLSTKKRSMTEAISXXXXXXXXXXX 412
MA D + D++ F+++Y KEYTGP S + ++ + KRS +
Sbjct: 1 MANIPDPDIDDD-FRDLY-KEYTGPAG--SGSVQERAKSNKRS-----NAGSDEEDEVRD 51

Query: 413 XXXVPTDFTSREAKVWEANAKA 478
+PT F SR+AKVWEA +KA
Sbjct: 52 PNAIPTGFISRDAKVWEAKSKA 73


>tr|A8WKH1|A8WKH1_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG24330 PE=4 SV=2
Length = 328

Score = 33.1 bits (74), Expect = 7.0
Identities = 36/96 (37%), Positives = 48/96 (50%), Gaps = 3/96 (3%)
Frame = -3

Query: 469 IRLPH-FSFPTCEISGHSIRIRRGLVLIRFIANCFCH*PFLGA--QIIPSIVTDRPNGSC 299
+R+ H F TC + IRI G V +R IAN FC LG+ ++ PS V P
Sbjct: 93 LRVIHLFWIRTCGLV--EIRICFGFVFLRNIANRFCLMFRLGSATRLSPSCVRFIP---- 146

Query: 298 VLFSINLLKPFLISFVIFGFRH*CEKYEENLFLPYV 191
LF++ L +ISF +F EKY+E PYV
Sbjct: 147 -LFAVIFL--LVISFTVFKSSG-IEKYQERTNAPYV 178