BP914655
Clone id YMU001_000061_D09
Library
Length 484
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000061_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AAATTTGTTTTTGCTTCTCCACAACCATAAGAAAAATCTGTAGCCACATCTTCCTCTGCC
TCCATAATGGATGTGGCCTCATCTTTCTTAATAAATCCATGCACTTGCTGCACAACAATA
GGACATTCCACTCTTACTCTCATAAGCATGACCACCAATATGCGATTGCATAATGGTTTT
ACGTACATATCCAAATTTCCACCCTTGATGCATCCATATGCTCCTCTTGTACATCACCAA
TGACATCAACTCATCCTTCTTATTGTCATCACAAGCTGACTTCCAAAAGCTTGAACTCAA
ATTATCCTCGTCCTTATCATAAGTTGACTCTGTATCGACATCTTCATCTTCCTAATTCTC
TAGGAGAGTTTGCCCACCCCTTAGTCTTTCCTCATTATATTTGTCCATGTATTCATGTTC
ACTTTCTTGATTCAAATCTGATATCTCCTTTTCATGTGCACACCCTTTGGCTAGGACCTC
ATCC
■■Homology search results ■■ -
sp_hit_id Q54FJ7
Definition sp|Q54FJ7|Y9094_DICDI Uncharacterized protein DDB_G0290803 OS=Dictyostelium discoideum
Align length 68
Score (bit) 33.1
E-value 0.68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914655|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_D09.
(484 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54FJ7|Y9094_DICDI Uncharacterized protein DDB_G0290803 OS=Di... 33 0.68
sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoid... 33 0.68
sp|Q8I3Z1|MLRR1_PLAF7 MATH and LRR domain-containing protein PFE... 33 0.68
sp|Q5ZKT9|MIER1_CHICK Mesoderm induction early response protein ... 33 0.88
sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax fas... 33 0.89
sp|P15202|CATA_YEAST Peroxisomal catalase A OS=Saccharomyces cer... 33 0.89
sp|P13816|GARP_PLAFF Glutamic acid-rich protein OS=Plasmodium fa... 32 1.5
sp|Q8WQ86|EB1_DICDI Microtubule-associated protein RP/EB family ... 32 1.5
sp|A9KKU1|GRPE_CLOPH Protein grpE OS=Clostridium phytofermentans... 32 2.0
sp|A1CE78|RT106_ASPCL Histone chaperone rtt106 OS=Aspergillus cl... 31 2.6
sp|Q99207|NOP14_YEAST Nucleolar complex protein 14 OS=Saccharomy... 31 2.6
sp|P55879|GLI3_CHICK Zinc finger protein GLI3 (Fragment) OS=Gall... 31 2.6
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation prote... 31 3.4
sp|Q54MB8|LEO1_DICDI RNA polymerase-associated protein LEO1 OS=D... 31 3.4
sp|Q6AY45|CL012_RAT Uncharacterized protein C12orf12 homolog OS=... 31 3.4
sp|Q92688|AN32B_HUMAN Acidic leucine-rich nuclear phosphoprotein... 31 3.4
sp|P06601|PRD_DROME Segmentation protein paired OS=Drosophila me... 31 3.4
sp|Q9LZ86|PLL2_ARATH Probable protein phosphatase 2C PLL2 OS=Ara... 31 3.4
sp|Q6FLB1|SPT6_CANGA Transcription elongation factor SPT6 OS=Can... 30 4.4
sp|Q9UTE6|MAK16_SCHPO Protein mak16 OS=Schizosaccharomyces pombe... 30 4.4
sp|P42869|UREE_YEREN Urease accessory protein ureE OS=Yersinia e... 30 4.4
sp|A1JKE0|UREE_YERE8 Urease accessory protein ureE OS=Yersinia e... 30 4.4
sp|Q9FM03|DOF56_ARATH Dof zinc finger protein DOF5.6 OS=Arabidop... 30 4.4
sp|Q2IYY5|UREE_RHOP2 Urease accessory protein ureE OS=Rhodopseud... 25 5.3
sp|P02642|TNNT2_CHICK Troponin T, cardiac muscle isoforms OS=Gal... 30 5.7
sp|Q8CFI7|RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2... 30 5.7
sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2... 30 5.7
sp|P06302|PTMA_RAT Prothymosin alpha OS=Rattus norvegicus GN=Ptm... 30 5.7
sp|Q8CDG5|CE041_MOUSE UPF0474 protein C5orf41 homolog OS=Mus mus... 30 5.7
sp|O60097|SPT8_SCHPO Transcription factor spt8 OS=Schizosaccharo... 30 7.5

>sp|Q54FJ7|Y9094_DICDI Uncharacterized protein DDB_G0290803
OS=Dictyostelium discoideum GN=DDB_G0290803 PE=4 SV=1
Length = 367

Score = 33.1 bits (74), Expect = 0.68
Identities = 21/68 (30%), Positives = 35/68 (51%)
Frame = -2

Query: 453 EKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWKSA 274
E + +D NQE++ EY + Y++E +G EN E + ES +K + WK+
Sbjct: 103 ENQENDENQEND-EYEENYDDEENQGNDEYEEN-ESVENHFESDSEKGDFEEMDQTWKTN 160

Query: 273 CDDNKKDE 250
DN+K +
Sbjct: 161 EKDNEKSD 168


>sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoideum
GN=mybX PE=3 SV=1
Length = 1620

Score = 33.1 bits (74), Expect = 0.68
Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
Frame = -2

Query: 456 HEKEIS-DLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWK 280
H KEI D N+E+E+E +K NE + ++ ++ E+ +KD +NLS S +
Sbjct: 1264 HNKEIEKDDNKENENE-KEKENENK-----------NEKQIENENEKEKDLNNLSES--Q 1309

Query: 279 SACDDNKKDELMS 241
S+ D +K +E MS
Sbjct: 1310 SSNDQSKSNEQMS 1322


>sp|Q8I3Z1|MLRR1_PLAF7 MATH and LRR domain-containing protein PFE0570w
OS=Plasmodium falciparum (isolate 3D7) GN=PFE0570w PE=2
SV=1
Length = 10061

Score = 33.1 bits (74), Expect = 0.68
Identities = 21/91 (23%), Positives = 45/91 (49%), Gaps = 3/91 (3%)
Frame = -2

Query: 480 EVLAKGCAHEKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDN 301
+V K +K ++D E ++E D+ N+E ++ +D+D D + D D+D+
Sbjct: 8294 KVSKKKMKKKKLLNDKEHEKDNEDNDEDNDEDDDDEDDDEDDEDDDDDDDDDDDDDDDDD 8353

Query: 300 LSSSF---WKSACDDNKKDELMSLVMYKRSI 217
+ + +NKK+E +++M K ++
Sbjct: 8354 YDEDYDEDYDEKLVENKKNERSNIIMSKENM 8384


>sp|Q5ZKT9|MIER1_CHICK Mesoderm induction early response protein 1
OS=Gallus gallus GN=MIER1 PE=2 SV=1
Length = 513

Score = 32.7 bits (73), Expect = 0.88
Identities = 20/66 (30%), Positives = 33/66 (50%)
Frame = -2

Query: 447 EISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWKSACD 268
EI DLN+ES+ + + G L E+ +DED + E +D+D++ + S C
Sbjct: 54 EIEDLNRESDMPIQELLSLYGYDGTIPLQEDDDDEDEEEEEEEGEDDDDVDNDD-NSGCS 112

Query: 267 DNKKDE 250
K+E
Sbjct: 113 GENKEE 118


>sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax
fasciatus GN=rx1 PE=2 SV=1
Length = 334

Score = 32.7 bits (73), Expect = 0.89
Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
Frame = +3

Query: 231 TSPMTSTHPSYCHHKLT--SKSLNSNYPRPYHKLTLYRHLHLPNSLGEFAHPLVFPHYIC 404
TSP+TST P + S+ L + YP + L+ P S+G+ P+ P Y C
Sbjct: 241 TSPLTSTTPVHSIPGFMGPSQGLQAGYPG-------HGFLNTPQSMGQSMQPMAPPPYQC 293

Query: 405 PCI 413
P +
Sbjct: 294 PAV 296


>sp|P15202|CATA_YEAST Peroxisomal catalase A OS=Saccharomyces
cerevisiae GN=CTA1 PE=1 SV=1
Length = 515

Score = 32.7 bits (73), Expect = 0.89
Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 3/68 (4%)
Frame = +3

Query: 114 NNRTFHSYS-HKHDHQYAIA*WFYVHIQISTLDA--SICSSCTSPMTSTHPSYCHHKLTS 284
N R+ H YS H + W YV + I T ++ + + ++P YC L
Sbjct: 205 NYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIKNLTIEEATKIAGSNPDYCQQDLFE 264

Query: 285 KSLNSNYP 308
N NYP
Sbjct: 265 AIQNGNYP 272


>sp|P13816|GARP_PLAFF Glutamic acid-rich protein OS=Plasmodium
falciparum (isolate FC27 / Papua New Guinea) GN=GARP
PE=4 SV=1
Length = 678

Score = 32.0 bits (71), Expect = 1.5
Identities = 19/68 (27%), Positives = 33/68 (48%)
Frame = -2

Query: 453 EKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWKSA 274
E E + +E E E ++ EE + E EDED + E ++DED+ +
Sbjct: 571 EVEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDEDEEDEDDAEEDEDDAEEDEDDAE 630

Query: 273 CDDNKKDE 250
DD+++D+
Sbjct: 631 EDDDEEDD 638


>sp|Q8WQ86|EB1_DICDI Microtubule-associated protein RP/EB family
member 1 OS=Dictyostelium discoideum GN=eb1 PE=1 SV=1
Length = 506

Score = 32.0 bits (71), Expect = 1.5
Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 8/57 (14%)
Frame = -2

Query: 447 EISDLNQESEHEYMDKY--NEERLRG------GQTLLEN*EDEDVDTESTYDKDEDN 301
E + NQ E E D++ +EE++ G ++L+N DED EST+D +ED+
Sbjct: 443 EEEEFNQHQEQEEEDEHFEDEEKVNGLNEEEIMNSVLQNASDEDDILESTFDGNEDD 499


>sp|A9KKU1|GRPE_CLOPH Protein grpE OS=Clostridium phytofermentans
(strain ATCC 700394 / DSM 18823 / ISDg) GN=grpE PE=3
SV=1
Length = 224

Score = 31.6 bits (70), Expect = 2.0
Identities = 23/68 (33%), Positives = 35/68 (51%)
Frame = -2

Query: 453 EKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWKSA 274
EK+I+ +NQ SE +D+ N+ + T E+ E+V E T +D SF+K
Sbjct: 20 EKDIARVNQASED--IDQENQSEVVDDTTENED-ASEEVYEEDTASEDGSKEKKSFFKKK 76

Query: 273 CDDNKKDE 250
+KKDE
Sbjct: 77 EKKDKKDE 84


>sp|A1CE78|RT106_ASPCL Histone chaperone rtt106 OS=Aspergillus
clavatus GN=rtt106 PE=3 SV=1
Length = 463

Score = 31.2 bits (69), Expect = 2.6
Identities = 17/69 (24%), Positives = 36/69 (52%)
Frame = -2

Query: 453 EKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWKSA 274
++E+ D E E +Y + E G + ++ ED++ D E ++ +++L ++ S
Sbjct: 395 QRELEDQEDEDEEDYDPGSDGESEGSGSSSEDDDEDDEDDEEDDDNEGDEDLVAAELGSE 454

Query: 273 CDDNKKDEL 247
+D +DEL
Sbjct: 455 AEDVPQDEL 463


tr_hit_id Q4YLP4
Definition tr|Q4YLP4|Q4YLP4_PLABE Putative uncharacterized protein OS=Plasmodium berghei
Align length 161
Score (bit) 43.9
E-value 0.004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914655|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_D09.
(484 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4YLP4|Q4YLP4_PLABE Putative uncharacterized protein OS=Plasm... 44 0.004
tr|Q7MS71|Q7MS71_WOLSU Putative uncharacterized protein hydC OS=... 37 0.37
tr|A8NTS6|A8NTS6_BRUMA Putative uncharacterized protein OS=Brugi... 37 0.49
tr|Q17L58|Q17L58_AEDAE E1a binding protein P400 OS=Aedes aegypti... 37 0.63
tr|Q5A0E1|Q5A0E1_CANAL Putative uncharacterized protein (Putativ... 37 0.63
tr|Q4T031|Q4T031_TETNG Chromosome undetermined SCAF11373, whole ... 37 0.63
tr|Q9ET15|Q9ET15_MOUSE Retinitis pigmentosa GTPase regulator (Fr... 36 0.82
tr|Q6Y7X4|Q6Y7X4_9POAL DNA-directed RNA polymerase beta' subunit... 36 1.1
tr|A8WUY7|A8WUY7_CAEBR CBR-GON-4 protein OS=Caenorhabditis brigg... 36 1.1
tr|Q1DRY9|Q1DRY9_COCIM Putative uncharacterized protein OS=Cocci... 36 1.1
tr|A5PMP6|A5PMP6_DANRE Novel protein similar to vertebrate compl... 35 1.4
tr|B3CDT6|B3CDT6_9BACE Putative uncharacterized protein OS=Bacte... 35 1.4
tr|Q6VVE5|Q6VVE5_PLAFA Rhoptry associated membrane antigen OS=Pl... 35 1.8
tr|A0D4Q4|A0D4Q4_PARTE Chromosome undetermined scaffold_38, whol... 35 1.8
tr|A5DRY9|A5DRY9_LODEL Putative uncharacterized protein OS=Lodde... 35 1.8
tr|Q4S5A8|Q4S5A8_TETNG Chromosome 19 SCAF14731, whole genome sho... 35 2.4
tr|Q4YUJ9|Q4YUJ9_PLABE Putative uncharacterized protein OS=Plasm... 35 2.4
tr|Q4YKU8|Q4YKU8_PLABE Putative uncharacterized protein OS=Plasm... 35 2.4
tr|A2F582|A2F582_TRIVA Putative uncharacterized protein OS=Trich... 35 2.4
tr|B3NGI9|B3NGI9_DROER GG14055 OS=Drosophila erecta GN=GG14055 P... 35 2.4
tr|B5X1E4|B5X1E4_SALSA U3 small nucleolar RNA-associated protein... 34 3.1
tr|Q6Y7X6|Q6Y7X6_9POAL DNA-directed RNA polymerase beta' subunit... 34 3.1
tr|Q8IBN8|Q8IBN8_PLAF7 DEAD box helicase, putative OS=Plasmodium... 34 3.1
tr|A7UUK5|A7UUK5_ANOGA AGAP008267-PA OS=Anopheles gambiae GN=AGA... 34 3.1
tr|A7U5X0|A7U5X0_PLAFA DEAD-box helicase 10 OS=Plasmodium falcip... 34 3.1
tr|Q8IQ69|Q8IQ69_DROME CG32397 OS=Drosophila melanogaster GN=CG3... 34 3.1
tr|Q95BH0|Q95BH0_PASGE DNA-directed RNA polymerase beta' subunit... 34 4.1
tr|A5BZE3|A5BZE3_VITVI Putative uncharacterized protein OS=Vitis... 34 4.1
tr|Q8ID30|Q8ID30_PLAF7 Putative uncharacterized protein PF13_035... 34 4.1
tr|Q7RT06|Q7RT06_PLAYO Putative uncharacterized protein PY00195 ... 34 4.1

>tr|Q4YLP4|Q4YLP4_PLABE Putative uncharacterized protein
OS=Plasmodium berghei GN=PB400804.00.0 PE=4 SV=1
Length = 202

Score = 43.9 bits (102), Expect = 0.004
Identities = 40/161 (24%), Positives = 61/161 (37%), Gaps = 19/161 (11%)
Frame = +3

Query: 39 CSHIFLCLHNGCGLIFLNKSMHLLHNNRTF-------HSYSHKHDHQYAIA*WFYVHIQI 197
C++++ N C + MH + T+ HS H H H AI ++HI I
Sbjct: 41 CAYVYT---NSCTCTYTFIHMHTYTHEHTYTYLCTCMHSPMHMHTHTCAIHVHTHIHIHI 97

Query: 198 STLDASICSSCTSPM---------TSTHPSYCHHKLTSKSLNSNYPRPYHKLTLYRHLH- 347
C+ +PM TH H T K +N + P HK +++ H H
Sbjct: 98 HQ-----CTCIHTPMHMHAQTCAHACTHTHVHAHAYTYKHMNIHMPMYMHKQSMHMHKHT 152

Query: 348 --LPNSLGEFAHPLVFPHYICPCIHVHFLDSNLISPFHVHT 464
+ A ++ H C CIH +P HVH+
Sbjct: 153 CAMHAYTCTHASTCIYTH-PCTCIH---------TPVHVHS 183


>tr|Q7MS71|Q7MS71_WOLSU Putative uncharacterized protein hydC
OS=Wolinella succinogenes GN=hydC PE=4 SV=1
Length = 380

Score = 37.4 bits (85), Expect = 0.37
Identities = 21/66 (31%), Positives = 30/66 (45%)
Frame = +3

Query: 252 HPSYCHHKLTSKSLNSNYPRPYHKLTLYRHLHLPNSLGEFAHPLVFPHYICPCIHVHFLD 431
HPSY H +T +L S R +++ R LH F HP + C H+HF D
Sbjct: 298 HPSYFPHAITRSNLQSQKYR-LSRISFIRELHAKIPPKLFEHPAIKTRSNCQACHLHF-D 355

Query: 432 SNLISP 449
++ P
Sbjct: 356 EGILQP 361


>tr|A8NTS6|A8NTS6_BRUMA Putative uncharacterized protein OS=Brugia
malayi GN=Bm1_09695 PE=4 SV=1
Length = 274

Score = 37.0 bits (84), Expect = 0.49
Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
Frame = +3

Query: 87 LNKSMHLLHNNRTFHSY-SHKHDHQYAIA*WFYVHIQISTLDASICSSCTSPMTSTHPSY 263
L+ S+H H+ R H Y H H H + I + I TL +S +S +S + S P Y
Sbjct: 16 LSSSLHHYHHQRYHHFYHRHHHQHHHII---IIITTIIITLSSSSSASLSSLLPSLSPHY 72

Query: 264 CHH 272
HH
Sbjct: 73 HHH 75



Score = 37.0 bits (84), Expect = 0.49
Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 10/96 (10%)
Frame = +3

Query: 87 LNKSMHLLHNNRTFHSYSHKHDHQYAIA*WFYVHIQ-------ISTLDAS---ICSSCTS 236
L+ H H++ +H + H H H Y I + I I+TL +S + SS +S
Sbjct: 68 LSPHYHHHHHHHCYHHHHHHHHHHYIIIIIIIITIVIIIVIIIITTLSSSSSLLSSSSSS 127

Query: 237 PMTSTHPSYCHHKLTSKSLNSNYPRPYHKLTLYRHL 344
P +S H Y HH ++ R +H Y H+
Sbjct: 128 PPSSLHYHYHHH---------HHHRYHHCYHHYHHI 154


>tr|Q17L58|Q17L58_AEDAE E1a binding protein P400 OS=Aedes aegypti
GN=AAEL001440 PE=4 SV=1
Length = 3081

Score = 36.6 bits (83), Expect = 0.63
Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 6/75 (8%)
Frame = -2

Query: 456 HEKEISDLNQESE---HEYMDKYNEERLRGG---QTLLEN*EDEDVDTESTYDKDEDNLS 295
H+KEI +LN E+E E M KYN G + + + +DE ++E+ D E+ +S
Sbjct: 737 HKKEIDELNAENEMSIEELMAKYNRPPPPGRRLEEKMDVDSDDEQSESEAESDSSEEQVS 796

Query: 294 SSFWKSACDDNKKDE 250
SS D KDE
Sbjct: 797 SSDEDMDGDQGDKDE 811


>tr|Q5A0E1|Q5A0E1_CANAL Putative uncharacterized protein (Putative
uncharacterized protein CaJ7.0484) OS=Candida albicans
GN=CaJ7.0484 PE=4 SV=1
Length = 552

Score = 36.6 bits (83), Expect = 0.63
Identities = 29/114 (25%), Positives = 46/114 (40%)
Frame = -2

Query: 483 DEVLAKGCAHEKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDED 304
+E+ KG E +I DL E D NEE G +D ++D ++ ED
Sbjct: 51 EEIDEKGSEKESDIEDLQDEDLFFIDDGNNEEHSSG--------DDMEIDQSEDEEEGED 102

Query: 303 NLSSSFWKSACDDNKKDELMSLVMYKRSIWMHQGWKFGYVRKTIMQSHIGGHAY 142
S + W+ + D+ L++ K+ +RKT S I G +Y
Sbjct: 103 QDSDNAWEDSDDEKVNISLLTSDKLKK------------LRKTPQDSVISGKSY 144


>tr|Q4T031|Q4T031_TETNG Chromosome undetermined SCAF11373, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00009544001 PE=4 SV=1
Length = 2172

Score = 36.6 bits (83), Expect = 0.63
Identities = 36/143 (25%), Positives = 52/143 (36%)
Frame = +3

Query: 39 CSHIFLCLHNGCGLIFLNKSMHLLHNNRTFHSYSHKHDHQYAIA*WFYVHIQISTLDASI 218
C H+ LH + L+ +H LH + H H ++H L
Sbjct: 1653 CGHLLHLLHP----LHLHHLLHPLHLHHLLHPLHLLHP--------LHLHHLHHLLHPLH 1700

Query: 219 CSSCTSPMTSTHPSYCHHKLTSKSLNSNYPRPYHKLTLYRHLHLPNSLGEFAHPLVFPHY 398
P+ HP Y HH L H L L LHL H L+ P +
Sbjct: 1701 LLHPLHPLHLLHPLYLHHLL-------------HPLHLLHPLHL--------HHLLHPLH 1739

Query: 399 ICPCIHVHFLDSNLISPFHVHTL 467
+ +H+H L +L+ P H+H L
Sbjct: 1740 LLHPLHLHHL-HHLLHPLHLHHL 1761


>tr|Q9ET15|Q9ET15_MOUSE Retinitis pigmentosa GTPase regulator
(Fragment) OS=Mus musculus GN=Rpgr PE=4 SV=1
Length = 538

Score = 36.2 bits (82), Expect = 0.82
Identities = 26/94 (27%), Positives = 44/94 (46%)
Frame = -2

Query: 453 EKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWKSA 274
EK+ D+ +E E E + +ER R E +DV+ + TYD++E + K A
Sbjct: 408 EKKKGDITEEEEEEEEGQEGDEREREEHGSCE----DDVEEDKTYDREEGEYKKAIGKVA 463

Query: 273 CDDNKKDELMSLVMYKRSIWMHQGWKFGYVRKTI 172
+++++D S + K + M G Y K I
Sbjct: 464 DNESQEDRKQSPKVSKINGSMKYGRHGTYSEKPI 497


>tr|Q6Y7X4|Q6Y7X4_9POAL DNA-directed RNA polymerase beta' subunit 2
(Fragment) OS=Setaria sphacelata GN=rpoC2 PE=4 SV=1
Length = 134

Score = 35.8 bits (81), Expect = 1.1
Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 10/94 (10%)
Frame = -2

Query: 453 EKEISDLNQESEHEYMDKYNEERLRGGQTLLEN*EDE----DVDTESTYDKDEDNLSSSF 286
E+E L ++SE EY NE + R G+ E ED+ + D+E Y EDN +
Sbjct: 40 EEEYRTLEKDSEEEYGSPENEYKTREGEGKYEILEDKYRTLEEDSEEEYGSSEDNSEKEY 99

Query: 285 --WKSACDDNKKDELMS----LVMYKRSIWMHQG 202
+ +++ +DE S ++ K S H+G
Sbjct: 100 GTLEEDSEEDSEDEYGSSEEDSILKKESFIEHRG 133


>tr|A8WUY7|A8WUY7_CAEBR CBR-GON-4 protein OS=Caenorhabditis briggsae
GN=Cbr-gon-4 PE=4 SV=2
Length = 1350

Score = 35.8 bits (81), Expect = 1.1
Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
Frame = -2

Query: 450 KEISDLNQESEHEYMDKYNEER--LRGGQTLLEN*EDEDVDTESTYDKDEDNLSSSFWKS 277
K DL E + EY D Y EER R E EDE++D E ++D+D +
Sbjct: 122 KNFLDLEYEEDDEYDDDYVEERDCSRQNDGEAEESEDEELDEEEE-EEDDDEDEEESKEV 180

Query: 276 ACDDNKKDE 250
DDN+K E
Sbjct: 181 DKDDNEKQE 189


>tr|Q1DRY9|Q1DRY9_COCIM Putative uncharacterized protein
OS=Coccidioides immitis GN=CIMG_06924 PE=4 SV=1
Length = 1090

Score = 35.8 bits (81), Expect = 1.1
Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 8/69 (11%)
Frame = -2

Query: 483 DEVLAKGCA---HEKEISDLNQESEHEYMDKY-----NEERLRGGQTLLEN*EDEDVDTE 328
D VL+ G + H+ EI +++ +S+ E DK ++E + G E+ E+++++ E
Sbjct: 13 DSVLSNGSSMIPHDAEIIEIDDDSDGEVQDKEVPMNEDDEEISEGD---EDDEEDEMEEE 69

Query: 327 STYDKDEDN 301
YD+DED+
Sbjct: 70 EDYDEDEDH 78