BP914673
Clone id YMU001_000061_F03
Library
Length 602
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000061_F03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGCCACGAAAACTTTGGTAATGCCAGCTATGCTGCTAATGGGGGTGTTTCCCTCACTCTA
GGTCTTCAACATTGTGAAGGACTCACATTTTCAGGTGGCCAACAACACTATGCGACGCAA
GGGGGCACACCGCACCTATTGACAAACAGACGAGAAGAGGATGGCTCTGCAGATTACTAC
AATGTAAATGAGAACGGCTATGAAGTGTTGGGTCTTCAGAGTAGAAAGCCCTTCCCTGCA
CACATGCTATGCCATGACTTTGTTGTTTAGAGGCAGGATTTGCTCTATATGGTGATGGCG
GCTTCTTTAAGCTTGCAAGCTCCTCACCGTGCTGAGCATTTAAATTCAACATAGGCTCCT
CATTATTTTCTCCCTTCTACCTAGTCCTTGGATCCCCCCGTTTCTAAGCTTTGCTTTCTT
GAAGAAATTGACTTCTTCATTGAAATGCATTGCTGCCATTATCCCACTGTCAATGTAAAT
TAGCATTGTGCAAATCTACTTGTAAGAAGGTTGTGAGTCTCTGCATCCCATATGCACACT
TATTAAAACAGGTTACCTTGTAAAGATAGTTAATTTTTCATGCTGCTTGCAGTGACTGAT
GG
■■Homology search results ■■ -
sp_hit_id Q9SJ56
Definition sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis thaliana
Align length 93
Score (bit) 35.8
E-value 0.16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914673|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_F03.
(587 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidop... 36 0.16
sp|P46589|ADF1_CANAL Adherence factor OS=Candida albicans GN=ADF... 33 1.1
sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidop... 32 2.3
sp|P49331|GTFD_STRMU Glucosyltransferase-S OS=Streptococcus muta... 30 8.9

>sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis
thaliana GN=BLH1 PE=1 SV=1
Length = 680

Score = 35.8 bits (81), Expect = 0.16
Identities = 30/93 (32%), Positives = 41/93 (44%), Gaps = 17/93 (18%)
Frame = +1

Query: 37 NGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYN-VNENG----- 198
N GVSLTLGL HC+ L+ + Q T G P RR + G + Y NG
Sbjct: 591 NNGVSLTLGLPHCDSLSSTHHQGFMQTHHGIP---IGRRVKIGETEEYGPATINGGSSTT 647

Query: 199 -----------YEVLGLQSRKPFPAHMLCHDFV 264
Y + +Q++K + A +L DFV
Sbjct: 648 TAHSSAAAAAAYNGMNIQNQKRYVAQLL-PDFV 679


>sp|P46589|ADF1_CANAL Adherence factor OS=Candida albicans GN=ADF1
PE=4 SV=2
Length = 612

Score = 33.1 bits (74), Expect = 1.1
Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 3/70 (4%)
Frame = -2

Query: 352 MLNLNAQHGEELASLKKPPSPYRA---NPASKQQSHGIACVQGRAFYSEDPTLHSRSHLH 182
M N N G S PP P +A N + ++ + + G +F E +LHS H H
Sbjct: 500 MPNQNTGSGATKISSTTPPPPSQALSNNVNTMNKNIVSSALGGTSFSQEQHSLHSNQHHH 559

Query: 181 CSNLQSHPLL 152
N Q HPL+
Sbjct: 560 --NHQQHPLI 567


>sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidopsis
thaliana GN=BLH9 PE=1 SV=1
Length = 575

Score = 32.0 bits (71), Expect = 2.3
Identities = 29/92 (31%), Positives = 36/92 (39%), Gaps = 4/92 (4%)
Frame = +1

Query: 1 GHENFGNASYAANGGVSLTLGLQHCEGLTF---SGGQQHYATQGGTPHLLTNRREEDGSA 171
G N + + NGGVSLTLGL H GL Q + GG+ DG
Sbjct: 498 GSSNVPVMNSSTNGGVSLTLGLHHQIGLPEPFPMTTAQRFGLDGGS---------GDGGG 548

Query: 172 DYYNVNEN-GYEVLGLQSRKPFPAHMLCHDFV 264
Y N G + +G + H HDFV
Sbjct: 549 GYEGQNRQFGRDFIGGSN------HQFLHDFV 574


>sp|P49331|GTFD_STRMU Glucosyltransferase-S OS=Streptococcus mutans
GN=gtfD PE=3 SV=3
Length = 1462

Score = 30.0 bits (66), Expect = 8.9
Identities = 14/47 (29%), Positives = 28/47 (59%)
Frame = +1

Query: 82 LTFSGGQQHYATQGGTPHLLTNRREEDGSADYYNVNENGYEVLGLQS 222
+T S G++ Y G + ++ NR D + D+Y +N +G ++G+Q+
Sbjct: 1227 ITGSDGKKRYFDDG-SGNMAVNRFANDKNGDWYYLNSDGIALVGVQT 1272


tr_hit_id A7PGE3
Definition tr|A7PGE3|A7PGE3_VITVI Chromosome chr6 scaffold_15, whole genome shotgun sequence OS=Vitis vinifera
Align length 82
Score (bit) 51.6
E-value 3.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914673|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_F03.
(587 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PGE3|A7PGE3_VITVI Chromosome chr6 scaffold_15, whole genome... 52 3e-05
tr|A5AZH8|A5AZH8_VITVI Putative uncharacterized protein OS=Vitis... 52 3e-05
tr|Q8LLE4|Q8LLE4_SOLTU BEL1-related homeotic protein 5 OS=Solanu... 41 0.044
tr|Q7XA55|Q7XA55_GNEGN Putative BEL1-like protein (Fragment) OS=... 41 0.057
tr|A7QHS3|A7QHS3_VITVI Chromosome chr8 scaffold_99, whole genome... 41 0.057
tr|A5B2N5|A5B2N5_VITVI Putative uncharacterized protein OS=Vitis... 41 0.057
tr|Q7Y0Z7|Q7Y0Z7_SOLLC Bell-like homeodomain protein 2 OS=Solanu... 40 0.074
tr|B2ZTD2|B2ZTD2_9SOLN BEL5 protein OS=Solanum etuberosum PE=2 SV=1 40 0.097
tr|B2ZTC8|B2ZTC8_SOLBR BEL5 protein OS=Solanum brevidens PE=2 SV=1 40 0.097
tr|Q52UM0|Q52UM0_FRAAN BEL1-related homeotic protein 30 (Fragmen... 40 0.13
tr|Q2PF41|Q2PF41_TRIPR BEL1-like homeodomain transcription facto... 39 0.28
tr|Q4T1P0|Q4T1P0_TETNG Chromosome undetermined SCAF10522, whole ... 35 3.1
tr|Q5KFF5|Q5KFF5_CRYNE Putative uncharacterized protein OS=Crypt... 35 3.1
tr|Q55QR1|Q55QR1_CRYNE Putative uncharacterized protein OS=Crypt... 35 3.1
tr|Q8LLD9|Q8LLD9_SOLTU BEL1-related homeotic protein 29 (Fragmen... 35 4.1
tr|A7P7U4|A7P7U4_VITVI Chromosome chr3 scaffold_8, whole genome ... 35 4.1
tr|A5AV94|A5AV94_VITVI Putative uncharacterized protein OS=Vitis... 35 4.1
tr|Q73X66|Q73X66_MYCPA AlkA OS=Mycobacterium paratuberculosis GN... 34 5.3
tr|B2ZTD3|B2ZTD3_9SOLN BEL29 protein OS=Solanum etuberosum PE=2 ... 34 5.3
tr|A2EB57|A2EB57_TRIVA Surface antigen BspA-like OS=Trichomonas ... 33 9.1

>tr|A7PGE3|A7PGE3_VITVI Chromosome chr6 scaffold_15, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017517001
PE=3 SV=1
Length = 728

Score = 51.6 bits (122), Expect = 3e-05
Identities = 34/82 (41%), Positives = 45/82 (54%), Gaps = 9/82 (10%)
Frame = +1

Query: 46 VSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREE--DGSADYYNVN-------ENG 198
VSLTLGL HCE L+ SG QQ Y + P++ RR E +G DY +N
Sbjct: 650 VSLTLGLPHCENLSLSGSQQSYLS---NPNVQLGRRLEMGNGEPDYCGINAAQPSHSNAA 706

Query: 199 YEVLGLQSRKPFPAHMLCHDFV 264
Y+ + +Q+RK F A +L DFV
Sbjct: 707 YDSINIQNRKRFAAQLL-PDFV 727


>tr|A5AZH8|A5AZH8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_027380 PE=3 SV=1
Length = 728

Score = 51.6 bits (122), Expect = 3e-05
Identities = 34/82 (41%), Positives = 45/82 (54%), Gaps = 9/82 (10%)
Frame = +1

Query: 46 VSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREE--DGSADYYNVN-------ENG 198
VSLTLGL HCE L+ SG QQ Y + P++ RR E +G DY +N
Sbjct: 650 VSLTLGLPHCENLSLSGSQQSYLS---NPNVQLGRRLEMGNGEPDYCGINAAQPSHSNAA 706

Query: 199 YEVLGLQSRKPFPAHMLCHDFV 264
Y+ + +Q+RK F A +L DFV
Sbjct: 707 YDSINIQNRKRFAAQLL-PDFV 727


>tr|Q8LLE4|Q8LLE4_SOLTU BEL1-related homeotic protein 5 OS=Solanum
tuberosum GN=Bel5 PE=2 SV=1
Length = 688

Score = 41.2 bits (95), Expect = 0.044
Identities = 33/88 (37%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
Frame = +1

Query: 4 HENFGNASYAANGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYN 183
H+ A++ N GVSLTLGL E L QQ+Y + R E GS +
Sbjct: 606 HDQQMTANFHGNNGVSLTLGLPPSENLAMPVSQQNYLSND------LGSRSEMGS----H 655

Query: 184 VNENGYEVLGLQS-RKPFPAHMLCHDFV 264
N GYE + QS K FP +L DFV
Sbjct: 656 YNRMGYENIDFQSGNKRFPTQLL-PDFV 682


>tr|Q7XA55|Q7XA55_GNEGN Putative BEL1-like protein (Fragment)
OS=Gnetum gnemon GN=melbel3 PE=2 SV=1
Length = 376

Score = 40.8 bits (94), Expect = 0.057
Identities = 32/103 (31%), Positives = 44/103 (42%), Gaps = 18/103 (17%)
Frame = +1

Query: 4 HENFGNASYAANGGVSLTLGLQHCEGLTFS----GGQQHYA--------------TQGGT 129
H + + + GGVSLTLGLQHC+ L+ S Q YA +
Sbjct: 258 HHHHHHHKFGGIGGVSLTLGLQHCDDLSLSAAAAAAQHPYAGNQLPRRSDLGIESSSQFH 317

Query: 130 PHLLTNRREEDGSADYYNVNENGYEVLGLQSRKPFPAHMLCHD 258
PH + + GSA Y+ L L ++K F H+L HD
Sbjct: 318 PHQHIHSTSDVGSA----ATTPNYDTLNLHNQKRFATHLL-HD 355


>tr|A7QHS3|A7QHS3_VITVI Chromosome chr8 scaffold_99, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038902001
PE=3 SV=1
Length = 696

Score = 40.8 bits (94), Expect = 0.057
Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 7/79 (8%)
Frame = +1

Query: 34 ANGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYNV-------NE 192
+ GVSLTLGL HCE L+ SG Q + ++ RR + G + Y +
Sbjct: 614 SGNGVSLTLGLPHCENLSLSGTHQTFLP---NQNIQLGRRVDMGEPNEYGTINTTTPHST 670

Query: 193 NGYEVLGLQSRKPFPAHML 249
YE + +Q+ K F A +L
Sbjct: 671 AAYENINMQNGKRFAAQLL 689


>tr|A5B2N5|A5B2N5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_015358 PE=3 SV=1
Length = 709

Score = 40.8 bits (94), Expect = 0.057
Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 7/79 (8%)
Frame = +1

Query: 34 ANGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYNV-------NE 192
+ GVSLTLGL HCE L+ SG Q + ++ RR + G + Y +
Sbjct: 627 SGNGVSLTLGLPHCENLSLSGTHQTFLP---NQNIQLGRRVDMGEPNEYGTINTTTPHST 683

Query: 193 NGYEVLGLQSRKPFPAHML 249
YE + +Q+ K F A +L
Sbjct: 684 AAYENINMQNGKRFAAQLL 702


>tr|Q7Y0Z7|Q7Y0Z7_SOLLC Bell-like homeodomain protein 2 OS=Solanum
lycopersicum GN=BL2 PE=2 SV=1
Length = 699

Score = 40.4 bits (93), Expect = 0.074
Identities = 33/88 (37%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
Frame = +1

Query: 4 HENFGNASYAANGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYN 183
H+ A++ N GVSLTLGL E L QQ+Y + R E GS +
Sbjct: 617 HDQQMTANFHGNNGVSLTLGLPPSENLAMPVSQQNYLSNE------LGSRPEIGS----H 666

Query: 184 VNENGYEVLGLQS-RKPFPAHMLCHDFV 264
N GYE + QS K FP +L DFV
Sbjct: 667 YNRMGYENIDFQSGNKRFPTQLL-PDFV 693


>tr|B2ZTD2|B2ZTD2_9SOLN BEL5 protein OS=Solanum etuberosum PE=2 SV=1
Length = 698

Score = 40.0 bits (92), Expect = 0.097
Identities = 33/88 (37%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
Frame = +1

Query: 4 HENFGNASYAANGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYN 183
H+ A++ N GVSLTLGL E L QQ+Y + R E GS +
Sbjct: 616 HDQQMTANFHVNNGVSLTLGLPPSENLAMPVNQQNYLSNE------LGSRPEMGS----H 665

Query: 184 VNENGYEVLGLQS-RKPFPAHMLCHDFV 264
N GYE + QS K FP +L DFV
Sbjct: 666 YNRMGYENIEFQSGNKRFPTRLL-PDFV 692


>tr|B2ZTC8|B2ZTC8_SOLBR BEL5 protein OS=Solanum brevidens PE=2 SV=1
Length = 698

Score = 40.0 bits (92), Expect = 0.097
Identities = 33/88 (37%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
Frame = +1

Query: 4 HENFGNASYAANGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYN 183
H+ A++ N GVSLTLGL E L QQ+Y + R E GS +
Sbjct: 616 HDQQMTANFHGNNGVSLTLGLPPSENLAMPVNQQNYLSNE------LGSRPEMGS----H 665

Query: 184 VNENGYEVLGLQS-RKPFPAHMLCHDFV 264
N GYE + QS K FP +L DFV
Sbjct: 666 YNRMGYENIEFQSGNKRFPTQLL-PDFV 692


>tr|Q52UM0|Q52UM0_FRAAN BEL1-related homeotic protein 30 (Fragment)
OS=Fragaria ananassa PE=2 SV=1
Length = 100

Score = 39.7 bits (91), Expect = 0.13
Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 3/77 (3%)
Frame = +1

Query: 28 YAANGGVSLTLGLQHCEGLTFSGGQQHYATQGGTPHLLTNRREEDGSADYYN--VNENGY 201
+ + GVSLTLGLQHCEG + GTPH R++ D YN + G
Sbjct: 34 FGSGSGVSLTLGLQHCEG-------GNIPISSGTPHSFVAMRDD----DLYNAAASSIGT 82

Query: 202 EVLGLQSRKPF-PAHML 249
E + F P+H+L
Sbjct: 83 ETADFDQQHRFGPSHLL 99