BP914677
Clone id YMU001_000061_F07
Library
Length 650
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000061_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCCACAGAGGCTCTTCACTGATTCTCTAAGTTCTAAGTTCTGTGCAGCCAGCTCAAGTGG
TGTGGGCTCTTTTATGGAAACAGGAGACTCGGGCTTAAGACTCTGAGAAGGCTCTGTGGA
GCTGATAAGCCCCATAAAGTCCCGCTTCTTTCTCTCAATCCTCGCTTTTCTTGGCGTCTT
CGGTTTTGTTGACGTTCCTTTCCCTTTTGAGCTTGTACCATTGGGAAGCAGCTTCTTGTA
TAGGTCCTTCGCAGAGACACCATTTGCAATCTCTTTCTGCAAATCTTTGCGAGCTTCTTC
AAATTCCTTAAGTTGCTGCTCTGCAGTAAGAGTTGGCTTCCCAGCTTTCTCCCATCGGAC
ATAAGACTGAACTTGTATCAGCTCCTCCGGTATGTCACTGCTGGGAGCACTATCAGAGGC
ATCACCTTCACTTTTGAGCAATCTTAACCTCAAGCTATCAATGGATGTGCCTTTGGCCAC
TTCCTCTTGCAACTCCATCCTAGCTTTTTTGTACTCCTCCTTTTCCTGTTCTTTAGTGTA
ACTCTGTTTGCCATTCCTCTCCCATCGCAAGTACGACTGAACTTGTACAAGCTCCTCAGG
AATAGATATACTTGACACGTTTGAATCTGGTTCAGGTATCACCATCCGGA
■■Homology search results ■■ -
sp_hit_id Q8LPT9
Definition sp|Q8LPT9|GWD1_CITRE Alpha-glucan water dikinase, chloroplastic OS=Citrus reticulata
Align length 211
Score (bit) 147.0
E-value 6.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914677|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_F07.
(650 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8LPT9|GWD1_CITRE Alpha-glucan water dikinase, chloroplastic ... 147 6e-35
sp|Q9AWA5|GWD1_SOLTU Alpha-glucan water dikinase, chloroplastic ... 120 8e-27
sp|Q9SAC6|GWD1_ARATH Alpha-glucan water dikinase 1, chloroplasti... 68 4e-11
sp|Q9STV0|GWD2_ARATH Alpha-glucan water dikinase 2 OS=Arabidopsi... 36 0.15
sp|A6U5E2|GRPE_SINMW Protein grpE OS=Sinorhizobium medicae (stra... 32 2.9
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sap... 32 3.8
sp|Q92SK0|GRPE_RHIME Protein grpE OS=Rhizobium meliloti GN=grpE ... 31 4.9
sp|Q8Y3P9|CATA_LISMO Catalase OS=Listeria monocytogenes GN=kat P... 30 8.4
sp|Q926X0|CATA_LISIN Catalase OS=Listeria innocua GN=kat PE=3 SV=1 30 8.4

>sp|Q8LPT9|GWD1_CITRE Alpha-glucan water dikinase, chloroplastic
OS=Citrus reticulata GN=R1 PE=2 SV=1
Length = 1475

Score = 147 bits (370), Expect = 6e-35
Identities = 80/211 (37%), Positives = 116/211 (54%), Gaps = 5/211 (2%)
Frame = -3

Query: 639 IPEPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSI 460
+P S + ++S+PE+LVQ Q+YLRWER GKQ YT AR EL EE+ +GTS+
Sbjct: 214 LPSERSLIQNVSVPEDLVQTQAYLRWERKGKQIYTPEQEKEEYEAARTELLEEIVRGTSV 273

Query: 459 DSLRLRLL-----KXXXXXXXXXXXXXXXXELIQVQSYVRWEKAGKPTLTAEQQLKEFEE 295
+ LR +L + +L+Q+QSY+RWE+AGKP +A+QQL+EFEE
Sbjct: 274 EDLRAKLTNKNDRQEIKESSSHGTKNAIPDDLVQIQSYIRWERAGKPNYSADQQLREFEE 333

Query: 294 ARKDLQKEIANGVSAKDLYKKLLPNXXXXXXXXXXXXXXXPRKARIERKKRDFMGLISST 115
ARK+LQ E+ G+S +++KK+ R RI+RK+RDFM +++
Sbjct: 334 ARKELQSELEKGISLDEIWKKITKGEIQTKVSDQLKTKKYFRTERIQRKQRDFMQILNKH 393

Query: 114 EPSQSLKPESPVSIKEPTPLELAAQNLELRE 22
+ K V K TP+EL E +E
Sbjct: 394 VAEPTEKKNISVEPKALTPVELFVGATEEQE 424



Score = 61.2 bits (147), Expect = 4e-09
Identities = 30/72 (41%), Positives = 45/72 (62%)
Frame = -3

Query: 648 RMVIPEPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKG 469
R I E S+ + +IP++LVQ+QSY+RWER GK +Y+ +AR ELQ E+ KG
Sbjct: 286 RQEIKESSSHGTKNAIPDDLVQIQSYIRWERAGKPNYSADQQLREFEEARKELQSELEKG 345

Query: 468 TSIDSLRLRLLK 433
S+D + ++ K
Sbjct: 346 ISLDEIWKKITK 357


>sp|Q9AWA5|GWD1_SOLTU Alpha-glucan water dikinase, chloroplastic
OS=Solanum tuberosum GN=R1 PE=1 SV=2
Length = 1464

Score = 120 bits (300), Expect = 8e-27
Identities = 72/190 (37%), Positives = 101/190 (53%), Gaps = 5/190 (2%)
Frame = -3

Query: 609 ISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDSLRLRLLK- 433
+S+PEELVQ+QSYLRWER GKQ+Y AR LQEE+A+G SI +R RL K
Sbjct: 216 VSVPEELVQIQSYLRWERKGKQNYPPEKEKEEYEAARTVLQEEIARGASIQDIRARLTKT 275

Query: 432 ----XXXXXXXXXXXXXXXXELIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIA 265
+L Q Q+Y+RWEKAGKP E+Q++E EEAR++LQ E+
Sbjct: 276 NDKSQSKEEPLHVTKSDIPDDLAQAQAYIRWEKAGKPNYPPEKQIEELEEARRELQLELE 335

Query: 264 NGVSAKDLYKKLLPNXXXXXXXXXXXXXXXPRKARIERKKRDFMGLISSTEPSQSLKPES 85
G++ +L +K + RI+RKKRDF LI+ S +++ +
Sbjct: 336 KGITLDEL-RKTITKGEIKTKVEKHLKRSSFAVERIQRKKRDFGHLINKYTSSPAVQVQK 394

Query: 84 PVSIKEPTPL 55
++EP L
Sbjct: 395 --VLEEPPAL 402



Score = 53.5 bits (127), Expect = 9e-07
Identities = 26/67 (38%), Positives = 39/67 (58%)
Frame = -3

Query: 633 EPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDS 454
E +V+ IP++L Q Q+Y+RWE+ GK +Y +AR ELQ E+ KG ++D
Sbjct: 283 EEPLHVTKSDIPDDLAQAQAYIRWEKAGKPNYPPEKQIEELEEARRELQLELEKGITLDE 342

Query: 453 LRLRLLK 433
LR + K
Sbjct: 343 LRKTITK 349


>sp|Q9SAC6|GWD1_ARATH Alpha-glucan water dikinase 1, chloroplastic
OS=Arabidopsis thaliana GN=GWD1 PE=1 SV=2
Length = 1399

Score = 68.2 bits (165), Expect = 4e-11
Identities = 31/69 (44%), Positives = 45/69 (65%)
Frame = -3

Query: 639 IPEPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSI 460
+P + ++S+PE+LVQ+Q+YLRWER GKQ Y AR EL+EE+ +G S+
Sbjct: 199 LPTERNVKQNVSVPEDLVQIQAYLRWERKGKQMYNPEKEKEEYEAARTELREEMMRGASV 258

Query: 459 DSLRLRLLK 433
+ LR +LLK
Sbjct: 259 EDLRAKLLK 267



Score = 55.5 bits (132), Expect = 2e-07
Identities = 43/141 (30%), Positives = 67/141 (47%), Gaps = 20/141 (14%)
Frame = -3

Query: 381 LIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIANGVSAKDLYKKLLPNXXXXXX 202
L+Q+Q+Y+RWE+ GK E++ +E+E AR +L++E+ G S +DL KLL
Sbjct: 215 LVQIQAYLRWERKGKQMYNPEKEKEEYEAARTELREEMMRGASVEDLRAKLLKKDNSNES 274

Query: 201 XXXXXXXXXPRKA-----------------RIERKKRDFMGLISSTEPSQSLKPESPVSI 73
R+ +I+RK RD LI + ++PES S
Sbjct: 275 PKSNGTSSSGREEKKKVSKQPERKKNYNTDKIQRKGRDLTKLIYK-HVADFVEPESK-SS 332

Query: 72 KEP---TPLELAAQNLELRES 19
EP T LE+ A+ E +E+
Sbjct: 333 SEPRSLTTLEIYAKAKEEQET 353


>sp|Q9STV0|GWD2_ARATH Alpha-glucan water dikinase 2 OS=Arabidopsis
thaliana GN=GWD2 PE=2 SV=2
Length = 1278

Score = 36.2 bits (82), Expect = 0.15
Identities = 14/47 (29%), Positives = 31/47 (65%)
Frame = -3

Query: 381 LIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIANGVSAKDL 241
LI+ +++ W++ G+P +A +Q +++ A ++L E+A G+S +L
Sbjct: 134 LIERRAHKIWDRKGRPQSSAREQQIDYDNAVRELHAELARGISLDEL 180



Score = 32.3 bits (72), Expect = 2.2
Identities = 15/52 (28%), Positives = 28/52 (53%)
Frame = -3

Query: 603 IPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDSLR 448
IP+ L++ +++ W+R G+ + A EL E+A+G S+D L+
Sbjct: 130 IPKTLIERRAHKIWDRKGRPQSSAREQQIDYDNAVRELHAELARGISLDELQ 181


>sp|A6U5E2|GRPE_SINMW Protein grpE OS=Sinorhizobium medicae (strain
WSM419) GN=grpE PE=3 SV=1
Length = 208

Score = 32.0 bits (71), Expect = 2.9
Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
Frame = -3

Query: 123 SSTEPSQSLKPESPVSIKEPTPLELA-AQNLELRE 22
++ +P + +PE+ VS P PLELA A+N ELR+
Sbjct: 20 AAAQPETAEEPEADVSAAAPDPLELAKAENAELRD 54


>sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo
sapiens GN=MTMR1 PE=1 SV=4
Length = 665

Score = 31.6 bits (70), Expect = 3.8
Identities = 14/35 (40%), Positives = 18/35 (51%)
Frame = -3

Query: 372 VQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEI 268
V YVRW +P + Q LKE R +LQK +
Sbjct: 598 VNYYVRWNPRMRPQMPIHQNLKELLAVRAELQKRV 632


>sp|Q92SK0|GRPE_RHIME Protein grpE OS=Rhizobium meliloti GN=grpE
PE=3 SV=1
Length = 208

Score = 31.2 bits (69), Expect = 4.9
Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Frame = -3

Query: 123 SSTEPSQSLKPESPVSIKEPTPLELA-AQNLELRE 22
++ EP + KPE+ S P PLELA A++ ELR+
Sbjct: 20 TAAEPQAAEKPEADASTTAPDPLELARAESAELRD 54


>sp|Q8Y3P9|CATA_LISMO Catalase OS=Listeria monocytogenes GN=kat PE=3
SV=1
Length = 488

Score = 30.4 bits (67), Expect = 8.4
Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 6/51 (11%)
Frame = -3

Query: 360 VRW-EKAGKPTLTAEQ----QLKEFEEARKDLQKEIANGVSAK-DLYKKLL 226
+RW KAG L+ EQ Q KEF A +DL + I NG + DLY ++L
Sbjct: 214 LRWVPKAGIVNLSTEQASQIQAKEFNHASRDLYEAIENGDYPEWDLYVQVL 264


>sp|Q926X0|CATA_LISIN Catalase OS=Listeria innocua GN=kat PE=3 SV=1
Length = 488

Score = 30.4 bits (67), Expect = 8.4
Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 6/51 (11%)
Frame = -3

Query: 360 VRW-EKAGKPTLTAEQ----QLKEFEEARKDLQKEIANGVSAK-DLYKKLL 226
+RW KAG L+ EQ Q KEF A +DL + I NG + DLY ++L
Sbjct: 214 LRWVPKAGIVNLSTEQAAQIQAKEFNHASRDLYEAIENGDYPEWDLYVQVL 264


tr_hit_id Q0DC10
Definition tr|Q0DC10|Q0DC10_ORYSJ Os06g0498400 protein (Fragment) OS=Oryza sativa subsp. japonica
Align length 210
Score (bit) 138.0
E-value 3.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914677|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_F07.
(650 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0DC10|Q0DC10_ORYSJ Os06g0498400 protein (Fragment) OS=Oryza ... 138 3e-31
tr|B8B2U3|B8B2U3_ORYSI Putative uncharacterized protein OS=Oryza... 133 1e-29
tr|B5B3R3|B5B3R3_SOLLC Glucan water dikinase OS=Solanum lycopers... 127 4e-28
tr|B2M0R3|B2M0R3_SOLTU Starch-granule-bound R1 protein OS=Solanu... 124 5e-27
tr|A3BC18|A3BC18_ORYSJ Putative uncharacterized protein OS=Oryza... 97 6e-19
tr|A7QP24|A7QP24_VITVI Chromosome chr1 scaffold_135, whole genom... 88 5e-16
tr|A9RGK0|A9RGK0_PHYPA Predicted protein OS=Physcomitrella paten... 75 3e-12
tr|A9SFX9|A9SFX9_PHYPA Predicted protein OS=Physcomitrella paten... 71 7e-11
tr|Q9SGX4|Q9SGX4_ARATH F20B24.19 OS=Arabidopsis thaliana PE=4 SV=1 68 4e-10
tr|A7QP23|A7QP23_VITVI Chromosome chr1 scaffold_135, whole genom... 49 3e-04
tr|Q00YU1|Q00YU1_OSTTA Myosin heavy chain (ISS) OS=Ostreococcus ... 44 0.009
tr|A4S4T4|A4S4T4_OSTLU Predicted protein OS=Ostreococcus lucimar... 44 0.009
tr|A4S126|A4S126_OSTLU Predicted protein (Fragment) OS=Ostreococ... 44 0.009

>tr|Q0DC10|Q0DC10_ORYSJ Os06g0498400 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os06g0498400 PE=4 SV=1
Length = 1414

Score = 138 bits (347), Expect = 3e-31
Identities = 84/210 (40%), Positives = 115/210 (54%), Gaps = 7/210 (3%)
Frame = -3

Query: 615 SSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDSLRLRLL 436
SS +PE+LVQ+QSYLRWER GKQSYT AR EL EE+ KG S++ LR +L
Sbjct: 165 SSTVVPEDLVQIQSYLRWERKGKQSYTPEQEKEEYEAARTELIEELNKGVSLEKLRAKLT 224

Query: 435 K------XXXXXXXXXXXXXXXXELIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQK 274
K EL+QVQ+Y+RWEKAGKP E+QL EFEEARK+LQ
Sbjct: 225 KTPEATDSNAPASESTVTTKVPEELVQVQAYIRWEKAGKPNYAPEKQLVEFEEARKELQS 284

Query: 273 EIANGVSAKDLYKKLLPNXXXXXXXXXXXXXXXPRKARIERKKRDFMGLISSTEPS-QSL 97
E+ G S + L K+L RI+RKKRD + L+ +P+
Sbjct: 285 ELDKGTSVEQLRNKILKGNIETKVSKQLKDKKYFSVERIQRKKRDIVQLLKKHKPTVMEA 344

Query: 96 KPESPVSIKEPTPLELAAQNLELRESVKSL 7
+ E+P K+PT L+L ++L+ +++ + L
Sbjct: 345 QVETP---KQPTVLDLFTKSLQEQDNCEVL 371


>tr|B8B2U3|B8B2U3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23085 PE=4 SV=1
Length = 1460

Score = 133 bits (334), Expect = 1e-29
Identities = 83/213 (38%), Positives = 115/213 (53%), Gaps = 10/213 (4%)
Frame = -3

Query: 615 SSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXK---ARMELQEEVAKGTSIDSLRL 445
SS +PE+LVQ+QSYLRWER GKQSYT + AR EL EE+ KG S++ LR
Sbjct: 208 SSTVVPEDLVQIQSYLRWERKGKQSYTPEQEKACPEEYEAARTELIEELNKGVSLEKLRA 267

Query: 444 RLLKXXXXXXXXXXXXXXXXE------LIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKD 283
+L K L+QVQ+Y+RWEKAGKP E+QL EFEEARK+
Sbjct: 268 KLTKTPEATDSNAPASESTVTTKVPEELVQVQAYIRWEKAGKPNYAPEKQLVEFEEARKE 327

Query: 282 LQKEIANGVSAKDLYKKLLPNXXXXXXXXXXXXXXXPRKARIERKKRDFMGLISSTEPS- 106
LQ E+ G S + L K+L RI+RKKRD + L+ +P+
Sbjct: 328 LQSELDKGTSVEQLRNKILKGNIETKVSKQLKDKKYFSVERIQRKKRDIVQLLKKHKPTV 387

Query: 105 QSLKPESPVSIKEPTPLELAAQNLELRESVKSL 7
+ E+P K+PT L+L ++L+ +++ + L
Sbjct: 388 MEAQAETP---KQPTVLDLFTKSLQEQDNCEVL 417


>tr|B5B3R3|B5B3R3_SOLLC Glucan water dikinase OS=Solanum
lycopersicum GN=GWD PE=2 SV=1
Length = 1465

Score = 127 bits (320), Expect = 4e-28
Identities = 76/190 (40%), Positives = 105/190 (55%), Gaps = 5/190 (2%)
Frame = -3

Query: 609 ISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDSLRLRLLK- 433
+S+PEELVQ+QSYLRWER GKQ+YT AR ELQEE+A+G SI +R RL K
Sbjct: 217 VSVPEELVQIQSYLRWERKGKQNYTPEKEKEEYEAARTELQEEIARGASIQDIRARLTKT 276

Query: 432 ----XXXXXXXXXXXXXXXXELIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIA 265
+L QVQ+Y+RWEKAGKP E+Q++E EEAR++LQ E+
Sbjct: 277 NDKSQSKEEPPHVTESDIPDDLAQVQAYIRWEKAGKPNYPPERQIEELEEARRELQLELE 336

Query: 264 NGVSAKDLYKKLLPNXXXXXXXXXXXXXXXPRKARIERKKRDFMGLISSTEPSQSLKPES 85
G++ +L KK+ + RI+RKKRDF LI+ S +++ +
Sbjct: 337 KGITLDELRKKITKGEIKTKVEKHLKRSSFAVE-RIQRKKRDFGQLINKYPSSPAVQVQK 395

Query: 84 PVSIKEPTPL 55
++EP L
Sbjct: 396 --VLEEPPAL 403



Score = 56.6 bits (135), Expect = 1e-06
Identities = 27/67 (40%), Positives = 41/67 (61%)
Frame = -3

Query: 633 EPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDS 454
E +V+ IP++L QVQ+Y+RWE+ GK +Y +AR ELQ E+ KG ++D
Sbjct: 284 EEPPHVTESDIPDDLAQVQAYIRWEKAGKPNYPPERQIEELEEARRELQLELEKGITLDE 343

Query: 453 LRLRLLK 433
LR ++ K
Sbjct: 344 LRKKITK 350


>tr|B2M0R3|B2M0R3_SOLTU Starch-granule-bound R1 protein OS=Solanum
tuberosum GN=R1 PE=2 SV=1
Length = 1463

Score = 124 bits (311), Expect = 5e-27
Identities = 71/167 (42%), Positives = 93/167 (55%), Gaps = 5/167 (2%)
Frame = -3

Query: 609 ISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDSLRLRLLK- 433
+S+PEELVQ+QSYLRWER GKQ+YT AR ELQEE+A+G SI +R RL K
Sbjct: 216 VSVPEELVQIQSYLRWERKGKQNYTPEKEKEEYEAARTELQEEIARGASIQDIRARLTKT 275

Query: 432 ----XXXXXXXXXXXXXXXXELIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIA 265
+L Q Q+Y+RWEKAGKP E+Q++E EEAR++LQ E+
Sbjct: 276 NDKSQSKEEPLHVTKSEIPDDLAQAQAYIRWEKAGKPNYPPEKQIEELEEARRELQLELE 335

Query: 264 NGVSAKDLYKKLLPNXXXXXXXXXXXXXXXPRKARIERKKRDFMGLI 124
G++ +L KK+ + RI+RKKRDF LI
Sbjct: 336 KGITLDELRKKITKGEIKTKAEKHVKRSSFAVE-RIQRKKRDFGQLI 381



Score = 54.7 bits (130), Expect = 5e-06
Identities = 26/67 (38%), Positives = 40/67 (59%)
Frame = -3

Query: 633 EPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDS 454
E +V+ IP++L Q Q+Y+RWE+ GK +Y +AR ELQ E+ KG ++D
Sbjct: 283 EEPLHVTKSEIPDDLAQAQAYIRWEKAGKPNYPPEKQIEELEEARRELQLELEKGITLDE 342

Query: 453 LRLRLLK 433
LR ++ K
Sbjct: 343 LRKKITK 349


>tr|A3BC18|A3BC18_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_020590 PE=4 SV=1
Length = 1425

Score = 97.4 bits (241), Expect = 6e-19
Identities = 62/173 (35%), Positives = 90/173 (52%), Gaps = 7/173 (4%)
Frame = -3

Query: 504 ARMELQEEVAKGTSIDSLRLRLLKXXXXXXXXXXXXXXXXE------LIQVQSYVRWEKA 343
AR EL EE+ KG S++ LR +L K L+QVQ+Y+RWEKA
Sbjct: 189 ARTELIEELNKGVSLEKLRAKLTKTPEATDSNAPASESTVTTKVPEELVQVQAYIRWEKA 248

Query: 342 GKPTLTAEQQLKEFEEARKDLQKEIANGVSAKDLYKKLLPNXXXXXXXXXXXXXXXPRKA 163
GKP E+QL EFEEARK+LQ E+ G S + L K+L
Sbjct: 249 GKPNYAPEKQLVEFEEARKELQSELDKGTSVEQLRNKILKGNIETKVSKQLKDKKYFSVE 308

Query: 162 RIERKKRDFMGLISSTEPS-QSLKPESPVSIKEPTPLELAAQNLELRESVKSL 7
RI+RKKRD + L+ +P+ + E+P K+PT L+L ++L+ +++ + L
Sbjct: 309 RIQRKKRDIVQLLKKHKPTVMEAQVETP---KQPTVLDLFTKSLQEQDNCEVL 358



Score = 65.1 bits (157), Expect = 4e-09
Identities = 43/137 (31%), Positives = 67/137 (48%)
Frame = -3

Query: 636 PEPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSID 457
P +S V++ +PEELVQVQ+Y+RWE+ GK +Y +AR ELQ E+ KGTS++
Sbjct: 222 PASESTVTT-KVPEELVQVQAYIRWEKAGKPNYAPEKQLVEFEEARKELQSELDKGTSVE 280

Query: 456 SLRLRLLKXXXXXXXXXXXXXXXXELIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQ 277
LR ++LK ++ + Y E+ + Q LK+ + + Q
Sbjct: 281 QLRNKILKGNIETKVSKQ--------LKDKKYFSVERIQRKKRDIVQLLKKHKPTVMEAQ 332

Query: 276 KEIANGVSAKDLYKKLL 226
E + DL+ K L
Sbjct: 333 VETPKQPTVLDLFTKSL 349


>tr|A7QP24|A7QP24_VITVI Chromosome chr1 scaffold_135, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002767001
PE=4 SV=1
Length = 1200

Score = 87.8 bits (216), Expect = 5e-16
Identities = 50/124 (40%), Positives = 72/124 (58%)
Frame = -3

Query: 381 LIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIANGVSAKDLYKKLLPNXXXXXX 202
L+QVQ+Y+RWEKAGKP T +QQL+EFEEARKDLQ E+ G+S ++ KK++
Sbjct: 30 LVQVQAYIRWEKAGKPNYTPDQQLREFEEARKDLQTELEKGLSLDEIRKKMIKGEIQVKV 89

Query: 201 XXXXXXXXXPRKARIERKKRDFMGLISSTEPSQSLKPESPVSIKEPTPLELAAQNLELRE 22
RI+RKKRD M L+ ++ + ++P+ IK+ T L Q +L+E
Sbjct: 90 SKQQKSRRYFGVERIQRKKRDLMQLL-HRHVTEWTEEKTPIPIKK-TELTAVEQFAKLKE 147

Query: 21 SVKS 10
S
Sbjct: 148 EQDS 151



Score = 62.0 bits (149), Expect = 3e-08
Identities = 30/67 (44%), Positives = 44/67 (65%)
Frame = -3

Query: 633 EPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSIDS 454
+P S S IP+ELVQVQ+Y+RWE+ GK +YT +AR +LQ E+ KG S+D
Sbjct: 17 QPHSETKS-KIPDELVQVQAYIRWEKAGKPNYTPDQQLREFEEARKDLQTELEKGLSLDE 75

Query: 453 LRLRLLK 433
+R +++K
Sbjct: 76 IRKKMIK 82


>tr|A9RGK0|A9RGK0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_174645 PE=4 SV=1
Length = 1341

Score = 75.1 bits (183), Expect = 3e-12
Identities = 37/70 (52%), Positives = 50/70 (71%)
Frame = -3

Query: 648 RMVIPEPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKG 469
R+ IP+ + ++S I +PEELV +QSYLRWER G+Q+Y+ +AR ELQ EVA G
Sbjct: 140 RVDIPQSNVDLSGIHVPEELVGIQSYLRWERMGRQNYSPEQEKAEYEEARKELQREVALG 199

Query: 468 TSIDSLRLRL 439
TSID ++LRL
Sbjct: 200 TSIDKIKLRL 209



Score = 58.9 bits (141), Expect = 3e-07
Identities = 42/130 (32%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
Frame = -3

Query: 381 LIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIANGVS---------AKDLYKKL 229
L+ +QSY+RWE+ G+ + EQ+ E+EEARK+LQ+E+A G S D +K
Sbjct: 159 LVGIQSYLRWERMGRQNYSPEQEKAEYEEARKELQREVALGTSIDKIKLRLQGGDTGQKS 218

Query: 228 LPNXXXXXXXXXXXXXXXPRK----ARIERKKRDFMGLISSTEPSQSLKPESPVSIKEPT 61
N K +RI RKK L + +P KE +
Sbjct: 219 SGNGASKSDNNGGSKSSNNSKGRSVSRITRKKWSTDDLFNKFTAGARAGSNTPAPPKERS 278

Query: 60 PLELAAQNLE 31
PL+ AAQ LE
Sbjct: 279 PLQKAAQQLE 288


>tr|A9SFX9|A9SFX9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_129189 PE=4 SV=1
Length = 1338

Score = 70.9 bits (172), Expect = 7e-11
Identities = 36/71 (50%), Positives = 46/71 (64%)
Frame = -3

Query: 648 RMVIPEPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKG 469
R+ +P P VS+ IPEELV VQ+YLRWER G+Q+Y+ AR ELQ E+A+G
Sbjct: 121 RIDVPPPSLKVSNYDIPEELVGVQAYLRWERKGRQNYSPEHEKVEYEAARKELQLELAQG 180

Query: 468 TSIDSLRLRLL 436
SI L+ RLL
Sbjct: 181 VSITQLKARLL 191



Score = 57.0 bits (136), Expect = 1e-06
Identities = 41/138 (29%), Positives = 62/138 (44%), Gaps = 17/138 (12%)
Frame = -3

Query: 381 LIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIANGVSAKDLYKKLLPNXXXXXX 202
L+ VQ+Y+RWE+ G+ + E + E+E ARK+LQ E+A GVS L +LL
Sbjct: 140 LVGVQAYLRWERKGRQNYSPEHEKVEYEAARKELQLELAQGVSITQLKARLLGGGSEKVD 199

Query: 201 XXXXXXXXXPR-----------------KARIERKKRDFMGLISSTEPSQSLKPESPVSI 73
R A++ RK L+S S+ S +
Sbjct: 200 SSTVSKSDDNRVKPQEEIGEIKVLGKNLMAKVNRKTWSAEELLSRYTLDASVGLGSSLPP 259

Query: 72 KEPTPLELAAQNLELRES 19
+EPT L+ AA+NLE ++
Sbjct: 260 QEPTTLQKAAKNLEAADN 277


>tr|Q9SGX4|Q9SGX4_ARATH F20B24.19 OS=Arabidopsis thaliana PE=4 SV=1
Length = 1540

Score = 68.2 bits (165), Expect = 4e-10
Identities = 31/69 (44%), Positives = 45/69 (65%)
Frame = -3

Query: 639 IPEPDSNVSSISIPEELVQVQSYLRWERNGKQSYTXXXXXXXXXKARMELQEEVAKGTSI 460
+P + ++S+PE+LVQ+Q+YLRWER GKQ Y AR EL+EE+ +G S+
Sbjct: 333 LPTERNVKQNVSVPEDLVQIQAYLRWERKGKQMYNPEKEKEEYEAARTELREEMMRGASV 392

Query: 459 DSLRLRLLK 433
+ LR +LLK
Sbjct: 393 EDLRAKLLK 401



Score = 55.5 bits (132), Expect = 3e-06
Identities = 43/141 (30%), Positives = 67/141 (47%), Gaps = 20/141 (14%)
Frame = -3

Query: 381 LIQVQSYVRWEKAGKPTLTAEQQLKEFEEARKDLQKEIANGVSAKDLYKKLLPNXXXXXX 202
L+Q+Q+Y+RWE+ GK E++ +E+E AR +L++E+ G S +DL KLL
Sbjct: 349 LVQIQAYLRWERKGKQMYNPEKEKEEYEAARTELREEMMRGASVEDLRAKLLKKDNSNES 408

Query: 201 XXXXXXXXXPRKA-----------------RIERKKRDFMGLISSTEPSQSLKPESPVSI 73
R+ +I+RK RD LI + ++PES S
Sbjct: 409 PKSNGTSSSGREEKKKVSKQPERKKNYNTDKIQRKGRDLTKLIYK-HVADFVEPESK-SS 466

Query: 72 KEP---TPLELAAQNLELRES 19
EP T LE+ A+ E +E+
Sbjct: 467 SEPRSLTTLEIYAKAKEEQET 487


>tr|A7QP23|A7QP23_VITVI Chromosome chr1 scaffold_135, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002766001
PE=4 SV=1
Length = 251

Score = 48.9 bits (115), Expect = 3e-04
Identities = 20/35 (57%), Positives = 26/35 (74%)
Frame = -3

Query: 639 IPEPDSNVSSISIPEELVQVQSYLRWERNGKQSYT 535
+P + + S+PEELVQ+Q+YLRWER GKQ YT
Sbjct: 209 LPVKGKMIPNASVPEELVQIQAYLRWERKGKQMYT 243