BP914686
Clone id YMU001_000061_G06
Library
Length 556
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000061_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATATCAGCTATATGCGGAGATCAAGTGGGGCCACAATTACTATTCAAGAAACGAGAGGG
GTGCATGGTGAGATGACTGTAGAGATACATGGCACTGCTCCTCAAGTCCAGGCAGCACAA
CAACTTGTGCAGAATTTTATGGCTGGATCTTCTGCACCAGTTTCTTCATATAGTGGAGCC
GATACATCTTATTCTTCTTACAATACCCAGAGTTATTATCCATCAGCATCAGCAAGTGCC
TCAGGTTTAGCCATGAATAGCTACAGCTCATCATACAATGGGAGCCATGGATACTAGCTG
AGTCTGCACTATTGGGATATGGAGAGAACATTGGTCCCTAACCTTGAGACCTGTCAATTC
CTCGGTAGAAATCGGTAGCCAAGGTTGATGTAGTCACTCACCAACTCAAGTATGGAGAGG
ATGTATCTTGAAGATCTACTAACATGAGTTTGGGGACCAATGGTTTGTATATACTTGGTT
GAGTATCAATGTTCTCGGAGCGTCCTATTTATCAGTGGTCTCGGAGCATCTTGTAGGACC
AACTTTACATGCCAGG
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914686|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_G06.
(556 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A9NUV7
Definition tr|A9NUV7|A9NUV7_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 53
Score (bit) 69.3
E-value 1.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914686|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_G06.
(556 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUV7|A9NUV7_PICSI Putative uncharacterized protein OS=Picea... 69 1e-10
tr|B8LM14|B8LM14_PICSI Putative uncharacterized protein OS=Picea... 69 2e-10
tr|A9T1H6|A9T1H6_PHYPA Predicted protein (Fragment) OS=Physcomit... 67 6e-10
tr|Q9SR13|Q9SR13_ARATH Putative RNA-binding protein (AT3g04610/F... 62 2e-08
tr|Q58T16|Q58T16_ARATH FLK OS=Arabidopsis thaliana GN=FLK PE=4 SV=1 62 2e-08
tr|A9S676|A9S676_PHYPA Predicted protein (Fragment) OS=Physcomit... 60 8e-08
tr|B6U2B4|B6U2B4_MAIZE Nucleic acid binding protein OS=Zea mays ... 57 5e-07
tr|A7QMQ0|A7QMQ0_VITVI Chromosome undetermined scaffold_127, who... 57 5e-07
tr|A5ASG9|A5ASG9_VITVI Putative uncharacterized protein OS=Vitis... 57 5e-07
tr|A7PUN7|A7PUN7_VITVI Chromosome chr7 scaffold_31, whole genome... 57 9e-07
tr|A5C3D2|A5C3D2_VITVI Putative uncharacterized protein OS=Vitis... 57 9e-07
tr|Q0W9E4|Q0W9E4_SOLCO Putative RNA binding protein (Fragment) O... 56 1e-06
tr|Q8W5C2|Q8W5C2_ORYSA Putative RNA binding protein OS=Oryza sat... 54 4e-06
tr|Q10GH8|Q10GH8_ORYSJ Os03g0627500 protein OS=Oryza sativa subs... 54 4e-06
tr|B8AN46|B8AN46_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|A3AKL1|A3AKL1_ORYSJ Putative uncharacterized protein OS=Oryza... 50 6e-05
tr|Q2QMN6|Q2QMN6_ORYSJ FLK, putative, expressed OS=Oryza sativa ... 49 1e-04
tr|Q0IM50|Q0IM50_ORYSJ Os12g0597600 protein (Fragment) OS=Oryza ... 49 1e-04
tr|B7EC76|B7EC76_ORYSJ cDNA clone:J013062H18, full insert sequen... 49 1e-04
tr|A7QUD9|A7QUD9_VITVI Chromosome chr11 scaffold_177, whole geno... 49 2e-04
tr|B8A170|B8A170_MAIZE Putative uncharacterized protein OS=Zea m... 47 5e-04
tr|B6T5L0|B6T5L0_MAIZE KH domain containing protein OS=Zea mays ... 47 5e-04
tr|A5AF63|A5AF63_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|B8BMU2|B8BMU2_ORYSI Putative uncharacterized protein OS=Oryza... 44 0.004
tr|A3CJ44|A3CJ44_ORYSJ Putative uncharacterized protein OS=Oryza... 44 0.004
tr|B8A3G9|B8A3G9_MAIZE Putative uncharacterized protein OS=Zea m... 41 0.050
tr|B6TJ76|B6TJ76_MAIZE Nucleic acid binding protein OS=Zea mays ... 41 0.050
tr|B6T6U2|B6T6U2_MAIZE Nucleic acid binding protein OS=Zea mays ... 41 0.050
tr|Q9AY47|Q9AY47_ORYSA Putative nucleic acid binding protein OS=... 39 0.19
tr|Q7XC34|Q7XC34_ORYSJ Os10g0564000 protein OS=Oryza sativa subs... 39 0.19

>tr|A9NUV7|A9NUV7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 481

Score = 69.3 bits (168), Expect = 1e-10
Identities = 35/53 (66%), Positives = 38/53 (71%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTAPXXXXXXXXXXNFMAGSSAP 159
NISYMRR+SGATI +QETRGV GEMTVEI GTA NFMAG+S P
Sbjct: 380 NISYMRRNSGATIAVQETRGVPGEMTVEIRGTATQVQTAQQLIQNFMAGASGP 432


>tr|B8LM14|B8LM14_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 490

Score = 68.9 bits (167), Expect = 2e-10
Identities = 35/53 (66%), Positives = 38/53 (71%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTAPXXXXXXXXXXNFMAGSSAP 159
NISY RR+SGA ITI+ETRGV GEMTVEIHGTA NFMAG+S P
Sbjct: 340 NISYCRRNSGAIITIEETRGVPGEMTVEIHGTASQVQTAQQLIQNFMAGASGP 392


>tr|A9T1H6|A9T1H6_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_42908 PE=4 SV=1
Length = 375

Score = 67.0 bits (162), Expect = 6e-10
Identities = 34/52 (65%), Positives = 38/52 (73%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTAPXXXXXXXXXXNFMAGSSA 156
NISYMRR+SGATITIQETR V GEMTVEIHG+A NFM G+S+
Sbjct: 303 NISYMRRTSGATITIQETRSVPGEMTVEIHGSASQVQTAQQLIQNFMTGASS 354


>tr|Q9SR13|Q9SR13_ARATH Putative RNA-binding protein
(AT3g04610/F7O18_9) OS=Arabidopsis thaliana GN=At3g04610
PE=2 SV=1
Length = 577

Score = 62.4 bits (150), Expect = 2e-08
Identities = 32/53 (60%), Positives = 35/53 (66%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTAPXXXXXXXXXXNFMAGSSAP 159
NISY RR SGAT+TIQETRGV GEMTVE+ GT NFMA + AP
Sbjct: 479 NISYTRRLSGATVTIQETRGVPGEMTVEVSGTGSQVQTAVQLIQNFMAEAGAP 531


>tr|Q58T16|Q58T16_ARATH FLK OS=Arabidopsis thaliana GN=FLK PE=4 SV=1
Length = 577

Score = 62.4 bits (150), Expect = 2e-08
Identities = 32/53 (60%), Positives = 35/53 (66%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTAPXXXXXXXXXXNFMAGSSAP 159
NISY RR SGAT+TIQETRGV GEMTVE+ GT NFMA + AP
Sbjct: 479 NISYTRRLSGATVTIQETRGVPGEMTVEVSGTGSQVQTAVQLIQNFMAEAGAP 531


>tr|A9S676|A9S676_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_43419 PE=4 SV=1
Length = 355

Score = 60.1 bits (144), Expect = 8e-08
Identities = 29/33 (87%), Positives = 31/33 (93%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTA 99
NISYMRR+SGATITIQETR V GEMTVEIHG+A
Sbjct: 301 NISYMRRTSGATITIQETRSVPGEMTVEIHGSA 333


>tr|B6U2B4|B6U2B4_MAIZE Nucleic acid binding protein OS=Zea mays
PE=2 SV=1
Length = 524

Score = 57.4 bits (137), Expect = 5e-07
Identities = 29/53 (54%), Positives = 36/53 (67%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTAPXXXXXXXXXXNFMAGSSAP 159
+ISY+RR SGAT+TIQE+RG G+MTVEI GTA NFMA ++ P
Sbjct: 413 SISYIRRHSGATVTIQESRGAPGDMTVEITGTAAQVQTAQQLIQNFMAEAAPP 465


>tr|A7QMQ0|A7QMQ0_VITVI Chromosome undetermined scaffold_127, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00002157001 PE=4 SV=1
Length = 400

Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/33 (81%), Positives = 32/33 (96%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTA 99
+ISY+RR+SGAT+TIQETRGV GEMTVEI+GTA
Sbjct: 341 SISYIRRASGATVTIQETRGVPGEMTVEINGTA 373


>tr|A5ASG9|A5ASG9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007074 PE=4 SV=1
Length = 534

Score = 57.4 bits (137), Expect = 5e-07
Identities = 27/33 (81%), Positives = 32/33 (96%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTA 99
+ISY+RR+SGAT+TIQETRGV GEMTVEI+GTA
Sbjct: 421 SISYIRRASGATVTIQETRGVPGEMTVEINGTA 453


>tr|A7PUN7|A7PUN7_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023873001
PE=4 SV=1
Length = 433

Score = 56.6 bits (135), Expect = 9e-07
Identities = 28/52 (53%), Positives = 37/52 (71%)
Frame = +1

Query: 1 NISYMRRSSGATITIQETRGVHGEMTVEIHGTAPXXXXXXXXXXNFMAGSSA 156
NISY+RR+SGATI I+ET+GV GEMTVEI+G+ NFMA +++
Sbjct: 329 NISYVRRTSGATIAIEETKGVPGEMTVEINGSVSQVQTAQQLIQNFMAEAAS 380