BP914694
Clone id YMU001_000061_H03
Library
Length 538
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000061_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATCAGCTGAATTAACAAGACGGTGCAGGCATGCAGCTGCTTCAGTTGGTGACTTGATCT
TCATCTATGGTGGTCTTCGTGGTGATGTTTTGTTAGATGATCTTTTAGTAGCTGAGGGCC
CTGCGGCTGTCGAGACCACTAGTGCTGCTCTTCATGCAGCTGCTTCGAATGCTCCTAGTG
CCAATGGACAGTCTGCAACGCACGCCAACAATTTCCGGTCAAGTTATTTAAATGGCCGTG
CAATAGCCACTGAATTAGAGTCAACATCCAATGGGTCTGTGATTATGGGAACTCCTGTAG
CAGCTCCTGTTAATGGGGATGTGTCCATGGACATTAGTGCTGAGAATGCCATGTCACTTG
GCCATCAAAGAAGGGGCAGTAATGTGGAATCATTGGTTGAAGCGTCAGCCGCTGAAGCTG
AGGCTATAAGTGCAGCCTTGGCTGCTGCAAAAGCGAGACAAACATTGGAGCAAGGGAAAA
AAATGTTTCTGATAGCACCACGGAAACCGATTCTTCTGCGAGCAAAGAGCAGTCGTCC
■■Homology search results ■■ -
sp_hit_id Q9SJF0
Definition sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana
Align length 129
Score (bit) 67.0
E-value 5.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914694|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_H03.
(538 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 O... 67 5e-11
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 h... 65 3e-10
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 O... 64 5e-10
sp|Q60EX6|BSL1_ORYSJ Serine/threonine protein phosphatase BSL1 h... 37 0.079
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 O... 32 1.9

>sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2
OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2
Length = 1018

Score = 67.0 bits (162), Expect = 5e-11
Identities = 48/129 (37%), Positives = 60/129 (46%), Gaps = 6/129 (4%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
S ELTRRCRHAAA+VGDLIFIY AE
Sbjct: 413 SVELTRRCRHAAAAVGDLIFIYGGLRGGVLLDDLLVAED-----------LAAAETTYAA 461

Query: 183 XXXXXTHANNFRSSYLNGRAIATE------LESTSNGSVIMGTPVAAPVNGDVSMDISAE 344
A N L GR ++ ES ++G+V++G+PVA PVNGD+ DIS E
Sbjct: 462 SHAAAAAATNSPPGRLPGRYGFSDERNRELSESAADGAVVLGSPVAPPVNGDMHTDISPE 521

Query: 345 NAMSLGHQR 371
NA+ G +R
Sbjct: 522 NALLPGTRR 530


>sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2
homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2
SV=2
Length = 1009

Score = 64.7 bits (156), Expect = 3e-10
Identities = 42/123 (34%), Positives = 58/123 (47%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
S ELTRRCRHAAA+VGD+I++Y AE
Sbjct: 400 SVELTRRCRHAAAAVGDMIYVYGGLRGGVLLDDLLVAEDLAAAETTNAANQAAAIAAASD 459

Query: 183 XXXXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLG 362
R +Y + + ++ +G+V++GTPVAAPVNGD+ DIS ENA+ G
Sbjct: 460 IQAGREPG---RYAYNDEQTGQPATITSPDGAVVLGTPVAAPVNGDMYTDISPENAVIQG 516

Query: 363 HQR 371
+R
Sbjct: 517 QRR 519


>sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3
OS=Arabidopsis thaliana GN=BSL3 PE=2 SV=2
Length = 1006

Score = 63.9 bits (154), Expect = 5e-10
Identities = 45/123 (36%), Positives = 55/123 (44%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
S ELTRRCRHAAA+VGDLIFIY AE
Sbjct: 402 SVELTRRCRHAAAAVGDLIFIYGGLRGGVLLDDLLVAEDLAAAETTSAASHAAAAAAATN 461

Query: 183 XXXXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLG 362
+ S G EL ++ +V++G+PVA PVNGD+ DIS ENAM G
Sbjct: 462 TPPGRSPGRYGFSDERTG-----ELPESAPDAVVLGSPVAPPVNGDMYTDISTENAMVPG 516

Query: 363 HQR 371
+R
Sbjct: 517 IRR 519


>sp|Q60EX6|BSL1_ORYSJ Serine/threonine protein phosphatase BSL1
homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2
SV=1
Length = 883

Score = 36.6 bits (83), Expect = 0.079
Identities = 16/22 (72%), Positives = 19/22 (86%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIY 68
S++L RRCRHAAASVG I+IY
Sbjct: 324 SSDLLRRCRHAAASVGTQIYIY 345


>sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1
OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=1
Length = 881

Score = 32.0 bits (71), Expect = 1.9
Identities = 14/22 (63%), Positives = 17/22 (77%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIY 68
S EL RRCRH AASVG I+++
Sbjct: 321 SFELMRRCRHGAASVGIRIYVH 342


tr_hit_id A9SF24
Definition tr|A9SF24|A9SF24_PHYPA Serine/threonine protein phosphatase OS=Physcomitrella patens subsp. patens
Align length 125
Score (bit) 75.5
E-value 2.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914694|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_H03.
(538 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SF24|A9SF24_PHYPA Serine/threonine protein phosphatase OS=P... 75 2e-12
tr|B8ANI2|B8ANI2_ORYSI Putative uncharacterized protein OS=Oryza... 75 3e-12
tr|Q10G19|Q10G19_ORYSJ Serine/threonine protein phosphatase OS=O... 74 4e-12
tr|Q0DQ03|Q0DQ03_ORYSJ Serine/threonine protein phosphatase OS=O... 74 4e-12
tr|A3AKU8|A3AKU8_ORYSJ Serine/threonine protein phosphatase OS=O... 74 4e-12
tr|A7QVR2|A7QVR2_VITVI Serine/threonine protein phosphatase OS=V... 72 2e-11
tr|A9S2C2|A9S2C2_PHYPA Serine/threonine protein phosphatase OS=P... 71 3e-11
tr|A7QN37|A7QN37_VITVI Chromosome undetermined scaffold_130, who... 69 1e-10
tr|A9STN4|A9STN4_PHYPA Serine/threonine protein phosphatase OS=P... 68 3e-10
tr|A9TQY8|A9TQY8_PHYPA Serine/threonine protein phosphatase OS=P... 65 2e-09
tr|Q0ILV6|Q0ILV6_ORYSJ Serine/threonine protein phosphatase OS=O... 65 3e-09
tr|B8BN16|B8BN16_ORYSI Putative uncharacterized protein OS=Oryza... 65 3e-09
tr|A3BCU1|A3BCU1_ORYSJ Serine/threonine protein phosphatase OS=O... 65 3e-09
tr|A8I799|A8I799_ARATH Serine/threonine protein phosphatase OS=A... 64 5e-09
tr|A5AP85|A5AP85_VITVI Putative uncharacterized protein OS=Vitis... 50 1e-04
tr|A5B8Z7|A5B8Z7_VITVI Putative uncharacterized protein OS=Vitis... 47 8e-04
tr|A5B957|A5B957_VITVI Putative uncharacterized protein OS=Vitis... 41 0.045
tr|A7QNR3|A7QNR3_VITVI Chromosome undetermined scaffold_134, who... 40 0.100
tr|Q0DKT4|Q0DKT4_ORYSJ Serine/threonine protein phosphatase OS=O... 37 0.85
tr|A7QKF0|A7QKF0_VITVI Chromosome chr2 scaffold_112, whole genom... 36 1.1
tr|A7PU12|A7PU12_VITVI Serine/threonine protein phosphatase OS=V... 36 1.1
tr|A5BEN9|A5BEN9_VITVI Serine/threonine protein phosphatase OS=V... 36 1.1
tr|B2UP84|B2UP84_AKKM8 Putative uncharacterized protein OS=Akker... 35 1.9
tr|A8HNE3|A8HNE3_CHLRE Serine/threonine protein phosphatase (Fra... 35 1.9

>tr|A9SF24|A9SF24_PHYPA Serine/threonine protein phosphatase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_184262 PE=3 SV=1
Length = 986

Score = 75.5 bits (184), Expect = 2e-12
Identities = 51/125 (40%), Positives = 58/125 (46%), Gaps = 2/125 (1%)
Frame = +3

Query: 9 ELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXXXX 188
ELTRRCRHAAA+VGD IFIY A P
Sbjct: 365 ELTRRCRHAAAAVGDHIFIYGGLRGGDILDDLLVAGDPSAVETTPAASQIAAVSATSTVS 424

Query: 189 XXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLGH- 365
++ + TEL S SV MG+PVAAPVNGD SMDIS ENA+S GH
Sbjct: 425 PARSNKQQEMR-----KPSQTELSSADRASVAMGSPVAAPVNGDTSMDISTENAVSHGHR 479

Query: 366 -QRRG 377
+RRG
Sbjct: 480 TERRG 484


>tr|B8ANI2|B8ANI2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12812 PE=4 SV=1
Length = 1003

Score = 74.7 bits (182), Expect = 3e-12
Identities = 49/123 (39%), Positives = 59/123 (47%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
+ ELTRRCRHAAA+VGD IFIY AE
Sbjct: 395 AVELTRRCRHAAAAVGDQIFIYGGLRGGVLLDDLLVAEDLAAAETTTAANHAAASAAATN 454

Query: 183 XXXXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLG 362
T R +Y + RA T ES +GSV++GTPVA PVNGD+ DIS ENA+ G
Sbjct: 455 VQSGRTPG---RYAYNDERARQTAPESAQDGSVVLGTPVAPPVNGDMHTDISPENAVLQG 511

Query: 363 HQR 371
+R
Sbjct: 512 QRR 514


>tr|Q10G19|Q10G19_ORYSJ Serine/threonine protein phosphatase
OS=Oryza sativa subsp. japonica GN=LOC_Os03g44500 PE=3
SV=1
Length = 1003

Score = 74.3 bits (181), Expect = 4e-12
Identities = 49/123 (39%), Positives = 59/123 (47%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
+ ELTRRCRHAAA+VGD IFIY AE
Sbjct: 395 AVELTRRCRHAAAAVGDQIFIYGGLRGGVLLDDLLVAEDLAAAETTTAANHAAASAAATN 454

Query: 183 XXXXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLG 362
T R +Y + RA T ES +GSV++GTPVA PVNGD+ DIS ENA+ G
Sbjct: 455 VQSGRTPG---RYAYNDERARQTAPESAQDGSVVLGTPVAPPVNGDMYTDISPENAVLQG 511

Query: 363 HQR 371
+R
Sbjct: 512 QRR 514


>tr|Q0DQ03|Q0DQ03_ORYSJ Serine/threonine protein phosphatase
OS=Oryza sativa subsp. japonica GN=Os03g0646900 PE=3
SV=1
Length = 851

Score = 74.3 bits (181), Expect = 4e-12
Identities = 49/123 (39%), Positives = 59/123 (47%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
+ ELTRRCRHAAA+VGD IFIY AE
Sbjct: 215 AVELTRRCRHAAAAVGDQIFIYGGLRGGVLLDDLLVAEDLAAAETTTAANHAAASAAATN 274

Query: 183 XXXXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLG 362
T R +Y + RA T ES +GSV++GTPVA PVNGD+ DIS ENA+ G
Sbjct: 275 VQSGRTPG---RYAYNDERARQTAPESAQDGSVVLGTPVAPPVNGDMYTDISPENAVLQG 331

Query: 363 HQR 371
+R
Sbjct: 332 QRR 334


>tr|A3AKU8|A3AKU8_ORYSJ Serine/threonine protein phosphatase
OS=Oryza sativa subsp. japonica GN=OsJ_011420 PE=3 SV=1
Length = 951

Score = 74.3 bits (181), Expect = 4e-12
Identities = 49/123 (39%), Positives = 59/123 (47%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
+ ELTRRCRHAAA+VGD IFIY AE
Sbjct: 328 AVELTRRCRHAAAAVGDQIFIYGGLRGGVLLDDLLVAEDLAAAETTTAANHAAASAAATN 387

Query: 183 XXXXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLG 362
T R +Y + RA T ES +GSV++GTPVA PVNGD+ DIS ENA+ G
Sbjct: 388 VQSGRTPG---RYAYNDERARQTAPESAQDGSVVLGTPVAPPVNGDMYTDISPENAVLQG 444

Query: 363 HQR 371
+R
Sbjct: 445 QRR 447


>tr|A7QVR2|A7QVR2_VITVI Serine/threonine protein phosphatase
OS=Vitis vinifera GN=GSVIVT00007485001 PE=3 SV=1
Length = 978

Score = 72.0 bits (175), Expect = 2e-11
Identities = 47/123 (38%), Positives = 58/123 (47%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
+ ELTRRCRHAAA+VGDLIFIY AE
Sbjct: 371 AVELTRRCRHAAAAVGDLIFIYGGLRGGVLLDDLLVAEDLAAAETTSAASHAAAAAAASN 430

Query: 183 XXXXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLG 362
R +++ R T E+ +GSV++GTPVA PVNGD+ DIS ENAM G
Sbjct: 431 LQAGRLPG---RYGFIDERTRQTIPEAAPDGSVVLGTPVAPPVNGDMYTDISTENAMLQG 487

Query: 363 HQR 371
+R
Sbjct: 488 SRR 490


>tr|A9S2C2|A9S2C2_PHYPA Serine/threonine protein phosphatase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_162447 PE=3 SV=1
Length = 954

Score = 71.2 bits (173), Expect = 3e-11
Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 2/125 (1%)
Frame = +3

Query: 9 ELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXXXX 188
ELTRRCRHAAASVGD I++Y AE
Sbjct: 339 ELTRRCRHAAASVGDHIYLYGGLRGGVLLDDLLVAED--------LAAAETTSAALHQAA 390

Query: 189 XXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLGH- 365
+ ++ +S + +A+ + T++GSV+MG+PVAAP GD +MDIS ENA++ GH
Sbjct: 391 LHSSAPSSQPNSISSAKAVGDGRQKTADGSVMMGSPVAAPAAGDATMDISTENALAHGHR 450

Query: 366 -QRRG 377
+R+G
Sbjct: 451 SERKG 455


>tr|A7QN37|A7QN37_VITVI Chromosome undetermined scaffold_130, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00002351001 PE=4 SV=1
Length = 594

Score = 69.3 bits (168), Expect = 1e-10
Identities = 49/130 (37%), Positives = 60/130 (46%), Gaps = 7/130 (5%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
+ ELTRRCRHAAA+VGDLIFI AE
Sbjct: 77 AVELTRRCRHAAAAVGDLIFIDGGLRGGVLLDDLPVAED----------LATAETTSAAS 126

Query: 183 XXXXXTHANNFRSSYLNGR-------AIATELESTSNGSVIMGTPVAAPVNGDVSMDISA 341
A+N ++ L GR T E+ +GSV++GTP+A PVNGD+ DIS
Sbjct: 127 HAAAAAAASNLQAGRLPGRYGSIDERTRQTIPEAAPDGSVVLGTPIAPPVNGDMYTDIST 186

Query: 342 ENAMSLGHQR 371
ENAM G QR
Sbjct: 187 ENAMLQGSQR 196


>tr|A9STN4|A9STN4_PHYPA Serine/threonine protein phosphatase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_188328 PE=3 SV=1
Length = 962

Score = 68.2 bits (165), Expect = 3e-10
Identities = 50/132 (37%), Positives = 60/132 (45%), Gaps = 7/132 (5%)
Frame = +3

Query: 3 SAELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXX 182
S ELTRRCRHAAA+VGD IF+Y A P
Sbjct: 353 SNELTRRCRHAAAAVGDHIFMYGGLRGGVLLDDLLVAGDPSAVETFSV------------ 400

Query: 183 XXXXXTHANNFRSSYLNG-----RAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAEN 347
A++ +S N + TEL ST SV +G PVAAP NG SMD S EN
Sbjct: 401 -------ASHLPASQTNKQQDVRKPSQTELSSTDGASVAIGNPVAAPFNGHTSMDTSTEN 453

Query: 348 AMSLGH--QRRG 377
++S GH +RRG
Sbjct: 454 SVSHGHRTERRG 465


>tr|A9TQY8|A9TQY8_PHYPA Serine/threonine protein phosphatase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_149218 PE=3 SV=1
Length = 1047

Score = 65.1 bits (157), Expect = 2e-09
Identities = 46/125 (36%), Positives = 55/125 (44%), Gaps = 2/125 (1%)
Frame = +3

Query: 9 ELTRRCRHAAASVGDLIFIYXXXXXXXXXXXXXXAEGPXXXXXXXXXXXXXXXXXXXXXX 188
ELTRRCRHAAASVGDL+F+Y AE
Sbjct: 436 ELTRRCRHAAASVGDLVFMYGGLRGGVLLDDLLVAED---------LAAVETTPAALHAA 486

Query: 189 XXXTHANNFRSSYLNGRAIATELESTSNGSVIMGTPVAAPVNGDVSMDISAENAMSLGH- 365
H+ + + + SV+M PVAAPVNGD SMDIS NA+S GH
Sbjct: 487 AASHHSFSPHKPQEVRKVPHPDSLGADGASVLMANPVAAPVNGDTSMDISTANALSHGHR 546

Query: 366 -QRRG 377
+RRG
Sbjct: 547 NERRG 551