BP914701
Clone id YMU001_000061_H10
Library
Length 175
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000061_H10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCGGAAGTCCATGGTCATGAAGGAACCTTCCGGCACCAATTGCACTGTAAGATTGGGATT
CTCAGCCAGAATCTTGCTTTTGGCTTCCTCTCCTGACAATCCAACTAGCTCTGGCCATAT
CTTCTGTGGGCCCGTATTCACTTGGAAAACTGTTTGCCGGATTTGTGCTTGGATA
■■Homology search results ■■ -
sp_hit_id P08820
Definition sp|P08820|ICIS_VICFA Subtilisin inhibitor (Fragment) OS=Vicia faba
Align length 39
Score (bit) 45.8
E-value 7.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914701|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_H10.
(175 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P08820|ICIS_VICFA Subtilisin inhibitor (Fragment) OS=Vicia fa... 46 7e-05
sp|P16064|ICI1_PHAAN Subtilisin inhibitor 1 OS=Phaseolus angular... 45 1e-04
sp|P16063|ICIB_HORVU Subtilisin-chymotrypsin inhibitor CI-1B OS=... 44 2e-04
sp|P01053|ICI2_HORVU Subtilisin-chymotrypsin inhibitor-2A OS=Hor... 44 2e-04
sp|P81712|ICI1_CANLI Subtilisin inhibitor CLSI-I OS=Canavalia li... 44 3e-04
sp|P83472|ICI_LUMTE Chymotrypsin inhibitor OS=Lumbricus terrestr... 43 4e-04
sp|P01054|ICIC_HORVU Subtilisin-chymotrypsin inhibitor CI-1C OS=... 43 6e-04
sp|P82381|ICI_LINUS Proteinase inhibitor OS=Linum usitatissimum ... 42 0.001
sp|P19873|ITH5_CUCMA Inhibitor of trypsin and hageman factor OS=... 41 0.002
sp|P82977|ICIW_WHEAT Subtilisin-chymotrypsin inhibitor WSCI OS=T... 41 0.002
sp|P16062|ICIA_HORVU Subtilisin-chymotrypsin inhibitor CI-1A OS=... 41 0.002
sp|P08626|ICI3_HORVU Subtilisin-chymotrypsin inhibitor-2B (Fragm... 41 0.002
sp|P24076|BGIA_MOMCH Glu S.griseus protease inhibitor OS=Momordi... 40 0.004
sp|P08454|ICID_SOLTU Wound-induced proteinase inhibitor 1 OS=Sol... 37 0.040
sp|P16231|ICI1_SOLPE Wound-induced proteinase inhibitor 1 OS=Sol... 37 0.040
sp|P05118|ICI1_SOLLC Wound-induced proteinase inhibitor 1 OS=Sol... 35 0.089
sp|P80211|ATSI_AMACA Trypsin/subtilisin inhibitor OS=Amaranthus ... 35 0.12
sp|Q6XNP7|HPI_HEVBR Protease inhibitor HPI OS=Hevea brasiliensis... 35 0.15
sp|P20076|IER1_SOLLC Ethylene-responsive proteinase inhibitor 1 ... 34 0.20
sp|P83830|ICI_EISHO Chymotrypsin inhibitor (Fragment) OS=Eisenia... 34 0.20
sp|Q02214|ITR1_NICSY Trypsin inhibitor 1 OS=Nicotiana sylvestris... 34 0.26
sp|Q03199|IPIB_TOBAC Proteinase inhibitor I-B OS=Nicotiana tabac... 33 0.57
sp|P01051|ICIC_HIRME Eglin C OS=Hirudo medicinalis PE=1 SV=1 33 0.57
sp|Q03198|IPIA_TOBAC Proteinase inhibitor I-A OS=Nicotiana tabac... 32 0.98
sp|P01052|ICIA_SOLTU Chymotrypsin inhibitor I, A, B and C subuni... 32 0.98
sp|Q00783|ICI1_SOLTU Proteinase inhibitor 1 OS=Solanum tuberosum... 30 4.9

>sp|P08820|ICIS_VICFA Subtilisin inhibitor (Fragment) OS=Vicia faba
PE=1 SV=1
Length = 62

Score = 45.8 bits (107), Expect = 7e-05
Identities = 21/39 (53%), Positives = 29/39 (74%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPELVG+S EEA+ KI E P +Q+VP+ SF+T D++
Sbjct: 4 WPELVGVSAEEAR-KIKEEMPEAEIQVVPQDSFVTADYK 41


>sp|P16064|ICI1_PHAAN Subtilisin inhibitor 1 OS=Phaseolus angularis
PE=1 SV=1
Length = 92

Score = 45.1 bits (105), Expect = 1e-04
Identities = 19/47 (40%), Positives = 32/47 (68%)
Frame = -2

Query: 144 QVNTGPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDF 4
+ NT + WPELVG++ E+A++KI E ++ +Q+ P SF+T D+
Sbjct: 24 ETNTPTKTSWPELVGVTAEQAETKIKEEMVDVQIQVSPHDSFVTADY 70


>sp|P16063|ICIB_HORVU Subtilisin-chymotrypsin inhibitor CI-1B
OS=Hordeum vulgare PE=1 SV=1
Length = 83

Score = 43.9 bits (102), Expect = 2e-04
Identities = 16/44 (36%), Positives = 31/44 (70%)
Frame = -2

Query: 135 TGPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDF 4
+G ++ WPE+VG+S E+AK IL + P+ ++++P + + +DF
Sbjct: 22 SGAKRSWPEVVGMSAEKAKEIILRDKPDAQIEVIPVDAMVPLDF 65


>sp|P01053|ICI2_HORVU Subtilisin-chymotrypsin inhibitor-2A
OS=Hordeum vulgare PE=1 SV=2
Length = 84

Score = 43.9 bits (102), Expect = 2e-04
Identities = 19/39 (48%), Positives = 27/39 (69%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPELVG S EEAK IL + P + ++P G+ +TM++R
Sbjct: 25 WPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYR 63


>sp|P81712|ICI1_CANLI Subtilisin inhibitor CLSI-I OS=Canavalia
lineata PE=1 SV=1
Length = 65

Score = 43.5 bits (101), Expect = 3e-04
Identities = 20/39 (51%), Positives = 29/39 (74%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPELVG++ EEA+ KI E + +Q+VP GSF+T D++
Sbjct: 7 WPELVGVTAEEAE-KIKEEMSGVEIQVVPPGSFVTADYK 44


>sp|P83472|ICI_LUMTE Chymotrypsin inhibitor OS=Lumbricus terrestris
PE=1 SV=2
Length = 86

Score = 43.1 bits (100), Expect = 4e-04
Identities = 19/39 (48%), Positives = 29/39 (74%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPELVG + EEAK++IL + P+ +++ PE S +T D+R
Sbjct: 27 WPELVGETLEEAKAQILEDRPDAVIKVQPEHSPVTYDYR 65


>sp|P01054|ICIC_HORVU Subtilisin-chymotrypsin inhibitor CI-1C
OS=Hordeum vulgare PE=1 SV=1
Length = 77

Score = 42.7 bits (99), Expect = 6e-04
Identities = 16/44 (36%), Positives = 30/44 (68%)
Frame = -2

Query: 135 TGPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDF 4
+G + WPE+VG+S E+AK IL + PN ++++P + + ++F
Sbjct: 12 SGAKTSWPEVVGMSAEKAKEIILRDKPNAQIEVIPVDAMVPLNF 55


>sp|P82381|ICI_LINUS Proteinase inhibitor OS=Linum usitatissimum
PE=1 SV=1
Length = 69

Score = 41.6 bits (96), Expect = 0.001
Identities = 20/39 (51%), Positives = 25/39 (64%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPELVG SG A + + EN N+ ++ EGS MT DFR
Sbjct: 10 WPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFR 48


>sp|P19873|ITH5_CUCMA Inhibitor of trypsin and hageman factor
OS=Cucurbita maxima PE=1 SV=1
Length = 68

Score = 41.2 bits (95), Expect = 0.002
Identities = 18/39 (46%), Positives = 26/39 (66%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WP LVG+ G AK+ I +NPN+ ++ EG+ +T DFR
Sbjct: 9 WPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFR 47


>sp|P82977|ICIW_WHEAT Subtilisin-chymotrypsin inhibitor WSCI
OS=Triticum aestivum PE=1 SV=2
Length = 84

Score = 41.2 bits (95), Expect = 0.002
Identities = 18/39 (46%), Positives = 26/39 (66%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPELVG S EEAK IL + + ++P G+ +TM++R
Sbjct: 25 WPELVGKSVEEAKKVILQDKSEAQIVVLPVGTIVTMEYR 63


tr_hit_id A9NP96
Definition tr|A9NP96|A9NP96_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 52
Score (bit) 60.1
E-value 5.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914701|Adiantum capillus-veneris mRNA, clone:
YMU001_000061_H10.
(175 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NP96|A9NP96_PICSI Putative uncharacterized protein OS=Picea... 60 5e-08
tr|A0BEL5|A0BEL5_PARTE Chromosome undetermined scaffold_102, who... 53 9e-06
tr|A2ZIU0|A2ZIU0_ORYSI Putative uncharacterized protein OS=Oryza... 51 2e-05
tr|B6SNA6|B6SNA6_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B O... 50 6e-05
tr|B6SMU6|B6SMU6_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B O... 50 6e-05
tr|B6SGY0|B6SGY0_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B O... 50 6e-05
tr|Q0IPK2|Q0IPK2_ORYSJ Os12g0193100 protein OS=Oryza sativa subs... 49 1e-04
tr|Q41361|Q41361_SAMNI Pathogenesis-related protein PR-6 type (F... 48 2e-04
tr|Q2QNZ6|Q2QNZ6_ORYSJ cDNA, clone: J065025E22, full insert sequ... 48 3e-04
tr|B6UH04|B6UH04_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B O... 48 3e-04
tr|A2ZLE5|A2ZLE5_ORYSI Putative uncharacterized protein OS=Oryza... 48 3e-04
tr|Q6E676|Q6E676_ZEADI MPI OS=Zea diploperennis GN=mpi PE=4 SV=1 47 5e-04
tr|Q6E668|Q6E668_ZEADI MPI OS=Zea diploperennis GN=mpi PE=4 SV=1 47 5e-04
tr|Q6E664|Q6E664_ZEAPE MPI OS=Zea perennis GN=mpi PE=4 SV=1 47 5e-04
tr|Q6E663|Q6E663_ZEAPE MPI OS=Zea perennis GN=mpi PE=4 SV=1 47 5e-04
tr|Q6E658|Q6E658_ZEAPE MPI OS=Zea perennis GN=mpi PE=4 SV=1 47 5e-04
tr|Q6E648|Q6E648_TRIDA MPI OS=Tripsacum dactyloides GN=mpi PE=4 ... 47 5e-04
tr|B8QVU0|B8QVU0_ZEAMP Proteinase inhibitor OS=Zea mays subsp. p... 47 5e-04
tr|A0EEX1|A0EEX1_PARTE Chromosome undetermined scaffold_92, whol... 47 5e-04
tr|Q6E672|Q6E672_ZEADI MPI OS=Zea diploperennis GN=mpi PE=4 SV=1 47 6e-04
tr|Q2QNZ3|Q2QNZ3_ORYSJ Os12g0548700 protein OS=Oryza sativa subs... 47 6e-04
tr|A9TU23|A9TU23_PHYPA Predicted protein (Fragment) OS=Physcomit... 47 6e-04
tr|A3CI82|A3CI82_ORYSJ Putative uncharacterized protein OS=Oryza... 47 6e-04
tr|Q2XX00|Q2XX00_ZEAMP Protease inhibitor OS=Zea mays subsp. par... 46 8e-04
tr|Q42420|Q42420_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B O... 46 0.001
tr|Q2XX03|Q2XX03_ZEAMP Proteinase inhibitor OS=Zea mays subsp. p... 46 0.001
tr|Q2XX01|Q2XX01_ZEAMP Protease inhibitor OS=Zea mays subsp. par... 46 0.001
tr|Q2XWZ6|Q2XWZ6_ZEAMP Proteinase inhibitor OS=Zea mays subsp. p... 46 0.001
tr|Q2XWZ2|Q2XWZ2_ZEAMP Proteinase inhibitor OS=Zea mays subsp. p... 46 0.001
tr|Q2XWZ0|Q2XWZ0_ZEAMP Proteinase inhibitor OS=Zea mays subsp. p... 46 0.001

>tr|A9NP96|A9NP96_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=4 SV=1
Length = 97

Score = 60.1 bits (144), Expect = 5e-08
Identities = 26/52 (50%), Positives = 38/52 (73%)
Frame = -2

Query: 159 RQTVFQVNTGPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDF 4
++ +F+VNT P+ WPE+VG+SGE+AK KI AE P+L V ++ E S T D+
Sbjct: 24 QKRIFEVNTAPRGTWPEVVGISGEDAKKKIEAEYPDLKVLIMSENSIFTADY 75


>tr|A0BEL5|A0BEL5_PARTE Chromosome undetermined scaffold_102, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00028015001 PE=4 SV=1
Length = 71

Score = 52.8 bits (125), Expect = 9e-06
Identities = 27/49 (55%), Positives = 33/49 (67%)
Frame = -2

Query: 147 FQVNTGPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
F + G Q WPE VG + EEAK ILA+N L VQL+PE S +TMD+R
Sbjct: 3 FHLPQGKQS-WPECVGKTAEEAKQIILADNAELHVQLLPENSMVTMDYR 50


>tr|A2ZIU0|A2ZIU0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37748 PE=4 SV=1
Length = 84

Score = 51.2 bits (121), Expect = 2e-05
Identities = 23/38 (60%), Positives = 29/38 (76%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDF 4
WPELVG+S EEAK+KI E P L VQ+VP +F+T D+
Sbjct: 25 WPELVGVSSEEAKTKIGEERPELDVQVVPADAFVTTDY 62


>tr|B6SNA6|B6SNA6_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B
OS=Zea mays PE=4 SV=1
Length = 70

Score = 50.1 bits (118), Expect = 6e-05
Identities = 23/44 (52%), Positives = 32/44 (72%)
Frame = -2

Query: 132 GPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
G +K WPE+VGLS EEAK IL + P+ + ++P G+ +TMDFR
Sbjct: 9 GAKKSWPEVVGLSLEEAKRVILCDKPDADIVVLPVGTPVTMDFR 52


>tr|B6SMU6|B6SMU6_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B
OS=Zea mays PE=4 SV=1
Length = 71

Score = 50.1 bits (118), Expect = 6e-05
Identities = 23/44 (52%), Positives = 32/44 (72%)
Frame = -2

Query: 132 GPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
G +K WPE+VGLS EEAK IL + P+ + ++P G+ +TMDFR
Sbjct: 10 GAKKSWPEVVGLSLEEAKRVILCDKPDADIVVLPVGTPVTMDFR 53


>tr|B6SGY0|B6SGY0_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B
OS=Zea mays PE=4 SV=1
Length = 71

Score = 50.1 bits (118), Expect = 6e-05
Identities = 23/44 (52%), Positives = 32/44 (72%)
Frame = -2

Query: 132 GPQKIWPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
G +K WPE+VGLS EEAK IL + P+ + ++P G+ +TMDFR
Sbjct: 10 GAKKSWPEVVGLSLEEAKRVILCDKPDADIVVLPVGTPVTMDFR 53


>tr|Q0IPK2|Q0IPK2_ORYSJ Os12g0193100 protein OS=Oryza sativa subsp.
japonica GN=Os12g0193100 PE=4 SV=1
Length = 84

Score = 48.9 bits (115), Expect = 1e-04
Identities = 22/38 (57%), Positives = 28/38 (73%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDF 4
WPELVG+S E AK+KI E P L VQ+VP +F+T D+
Sbjct: 25 WPELVGVSSEAAKTKIGEERPELDVQVVPADAFVTTDY 62


>tr|Q41361|Q41361_SAMNI Pathogenesis-related protein PR-6 type
(Fragment) OS=Sambucus nigra PE=2 SV=1
Length = 79

Score = 48.1 bits (113), Expect = 2e-04
Identities = 21/39 (53%), Positives = 27/39 (69%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPEL G GEEA + + ENP++T +VPEGS +T D R
Sbjct: 20 WPELCGARGEEAAATVETENPSVTAVIVPEGSIVTTDER 58


>tr|Q2QNZ6|Q2QNZ6_ORYSJ cDNA, clone: J065025E22, full insert
sequence OS=Oryza sativa subsp. japonica
GN=LOC_Os12g36210 PE=4 SV=1
Length = 77

Score = 47.8 bits (112), Expect = 3e-04
Identities = 21/39 (53%), Positives = 29/39 (74%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPE+VGLS EEAK IL + P+ + ++P GS +T+DFR
Sbjct: 21 WPEVVGLSAEEAKKVILKDMPDADIVVLPAGSPVTLDFR 59


>tr|B6UH04|B6UH04_MAIZE Subtilisin-chymotrypsin inhibitor CI-1B
OS=Zea mays PE=4 SV=1
Length = 73

Score = 47.8 bits (112), Expect = 3e-04
Identities = 20/39 (51%), Positives = 29/39 (74%)
Frame = -2

Query: 117 WPELVGLSGEEAKSKILAENPNLTVQLVPEGSFMTMDFR 1
WPE+VG+S +EA+ IL + PN +Q++P GS +T DFR
Sbjct: 17 WPEVVGMSIKEAREIILKDMPNANIQVLPVGSLVTQDFR 55