BP914717
Clone id YMU001_000062_B03
Library
Length 369
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000062_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTGCCACAGCTCGCATCGCACAAGGAGTGTCGACTCTTAAAAGAAGACTTATACAATGAC
GAGGAGCAACAAATGCTGCCTACTTTGTCTTTGAGAAGGACACAGCAAGCCCACACATGT
GCCCACAAAGAATAAATCTAGAGGCTGAAAAAAATACGACGCACACTGTAGTTTAATGCT
TTCTTCGTGACTTCATCCCTGGGTCAACTATATATTAGCTCTTCCAATCATAAATGAGAC
ACCGGCAAGCATTGGCTCTTTTATATCCTACGTTAAGCAAAGACAGGTAAGAAAGACAAT
CACCATTTCCTCTGCAGCTCATTTACGCCTGCTTACTCTTCCAAGGCTGCAGAACTGACA
CCACTATAA
■■Homology search results ■■ -
sp_hit_id Q9FH09
Definition sp|Q9FH09|HDA7_ARATH Histone deacetylase 7 OS=Arabidopsis thaliana
Align length 40
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914717|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_B03.
(369 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FH09|HDA7_ARATH Histone deacetylase 7 OS=Arabidopsis thalia... 32 1.3
sp|P35993|HOX7P_XENLA Homeobox protein XHOX-7.1' (Fragment) OS=X... 30 3.7
sp|A4VX47|MURC_STRSY UDP-N-acetylmuramate--L-alanine ligase OS=S... 30 4.9
sp|A4W3F1|MURC_STRS2 UDP-N-acetylmuramate--L-alanine ligase OS=S... 30 4.9
sp|Q28DV3|HDAC3_XENTR Histone deacetylase 3 OS=Xenopus tropicali... 30 4.9
sp|Q6IRL9|HDAC3_XENLA Histone deacetylase 3 OS=Xenopus laevis GN... 30 4.9
sp|Q6P6W3|HDAC3_RAT Histone deacetylase 3 OS=Rattus norvegicus G... 30 4.9
sp|Q5RB76|HDAC3_PONAB Histone deacetylase 3 OS=Pongo abelii GN=H... 30 4.9
sp|O88895|HDAC3_MOUSE Histone deacetylase 3 OS=Mus musculus GN=H... 30 4.9
sp|O15379|HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens GN=H... 30 4.9
sp|P56520|HDAC3_CHICK Histone deacetylase 3 OS=Gallus gallus GN=... 30 4.9
sp|A3CPS7|MURC_STRSV UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q8DP40|MURC_STRR6 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q97PS8|MURC_STRPN UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q48V60|MURC_STRPM UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|A2RGA7|MURC_STRPG UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q1J8C6|MURC_STRPF UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q1JIH1|MURC_STRPD UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q1JNC1|MURC_STRPC UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q1JDE8|MURC_STRPB UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q8P2E1|MURC_STRP8 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q5XDR0|MURC_STRP6 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q8K8J5|MURC_STRP3 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q04HS5|MURC_STRP2 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q9A1C7|MURC_STRP1 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 6.4
sp|Q5U236|PERQ2_XENLA PERQ amino acid-rich with GYF domain-conta... 29 8.3
sp|Q03MH6|MURC_STRTD UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 8.3
sp|Q5M641|MURC_STRT2 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 8.3
sp|Q5M1J9|MURC_STRT1 UDP-N-acetylmuramate--L-alanine ligase OS=S... 29 8.3

>sp|Q9FH09|HDA7_ARATH Histone deacetylase 7 OS=Arabidopsis thaliana
GN=HDA7 PE=2 SV=1
Length = 409

Score = 31.6 bits (70), Expect = 1.3
Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = -3

Query: 322 MSCRGNGDCLSYLSLLNV--------GYKRANACRCLIYD 227
+S +G+GDCL Y+ NV GY N RC Y+
Sbjct: 279 LSIKGHGDCLQYVRSFNVPLMILGGGGYTLPNVARCWCYE 318


>sp|P35993|HOX7P_XENLA Homeobox protein XHOX-7.1' (Fragment)
OS=Xenopus laevis PE=2 SV=1
Length = 291

Score = 30.0 bits (66), Expect = 3.7
Identities = 15/29 (51%), Positives = 19/29 (65%)
Frame = +1

Query: 4 PQLASHKECRLLKEDLYNDEEQQMLPTLS 90
P L + R +KEDL +DEE Q+ PTLS
Sbjct: 24 PLLTAMSSPRRIKEDLSSDEEGQVHPTLS 52


>sp|A4VX47|MURC_STRSY UDP-N-acetylmuramate--L-alanine ligase
OS=Streptococcus suis (strain 05ZYH33) GN=murC PE=3 SV=1
Length = 443

Score = 29.6 bits (65), Expect = 4.9
Identities = 12/22 (54%), Positives = 13/22 (59%)
Frame = +3

Query: 60 RGATNAAYFVFEKDTASPHMCP 125
RG+ NA YFVFE D H P
Sbjct: 141 RGSANAQYFVFESDEYERHFAP 162


>sp|A4W3F1|MURC_STRS2 UDP-N-acetylmuramate--L-alanine ligase
OS=Streptococcus suis (strain 98HAH33) GN=murC PE=3 SV=1
Length = 443

Score = 29.6 bits (65), Expect = 4.9
Identities = 12/22 (54%), Positives = 13/22 (59%)
Frame = +3

Query: 60 RGATNAAYFVFEKDTASPHMCP 125
RG+ NA YFVFE D H P
Sbjct: 141 RGSANAQYFVFESDEYERHFAP 162


>sp|Q28DV3|HDAC3_XENTR Histone deacetylase 3 OS=Xenopus tropicalis
GN=hdac3 PE=2 SV=1
Length = 428

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = -3

Query: 322 MSCRGNGDCLSYLSLLNV--------GYKRANACRCLIYD 227
+S RG+G+C+ Y+ N+ GY N RC Y+
Sbjct: 271 LSIRGHGECVQYVKSFNIPLLVLGGGGYTVRNVARCWTYE 310


>sp|Q6IRL9|HDAC3_XENLA Histone deacetylase 3 OS=Xenopus laevis
GN=hdac3 PE=2 SV=2
Length = 428

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = -3

Query: 322 MSCRGNGDCLSYLSLLNV--------GYKRANACRCLIYD 227
+S RG+G+C+ Y+ N+ GY N RC Y+
Sbjct: 271 LSIRGHGECVQYVKSFNIPLLVLGGGGYTVRNVARCWTYE 310


>sp|Q6P6W3|HDAC3_RAT Histone deacetylase 3 OS=Rattus norvegicus
GN=Hdac3 PE=1 SV=1
Length = 428

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = -3

Query: 322 MSCRGNGDCLSYLSLLNV--------GYKRANACRCLIYD 227
+S RG+G+C+ Y+ N+ GY N RC Y+
Sbjct: 271 LSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYE 310


>sp|Q5RB76|HDAC3_PONAB Histone deacetylase 3 OS=Pongo abelii
GN=HDAC3 PE=2 SV=1
Length = 428

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = -3

Query: 322 MSCRGNGDCLSYLSLLNV--------GYKRANACRCLIYD 227
+S RG+G+C+ Y+ N+ GY N RC Y+
Sbjct: 271 LSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYE 310


>sp|O88895|HDAC3_MOUSE Histone deacetylase 3 OS=Mus musculus
GN=Hdac3 PE=1 SV=1
Length = 424

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = -3

Query: 322 MSCRGNGDCLSYLSLLNV--------GYKRANACRCLIYD 227
+S RG+G+C+ Y+ N+ GY N RC Y+
Sbjct: 271 LSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYE 310


>sp|O15379|HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens
GN=HDAC3 PE=1 SV=2
Length = 428

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = -3

Query: 322 MSCRGNGDCLSYLSLLNV--------GYKRANACRCLIYD 227
+S RG+G+C+ Y+ N+ GY N RC Y+
Sbjct: 271 LSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYE 310


tr_hit_id A5UZ93
Definition tr|A5UZ93|A5UZ93_ROSS1 Undecaprenyl-diphosphatase OS=Roseiflexus sp. (strain RS-1)
Align length 47
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914717|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_B03.
(369 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5UZ93|A5UZ93_ROSS1 Undecaprenyl-diphosphatase OS=Roseiflexus... 34 4.2
tr|B6AJ24|B6AJ24_9CRYT RNB-like domain-containing protein OS=Cry... 33 7.1

>tr|A5UZ93|A5UZ93_ROSS1 Undecaprenyl-diphosphatase OS=Roseiflexus
sp. (strain RS-1) GN=RoseRS_3591 PE=3 SV=1
Length = 286

Score = 33.9 bits (76), Expect = 4.2
Identities = 14/47 (29%), Positives = 24/47 (51%)
Frame = +2

Query: 191 LHPWVNYILALPIINETPASIGSFISYVKQRQVRKTITISSAAHLRL 331
LH W+ +L P++ T +G + + +R R+T T+ A L L
Sbjct: 117 LHGWIKAVLFSPVVIGTALIVGGIVLIIVERLPRRTATVHDATRLSL 163


>tr|B6AJ24|B6AJ24_9CRYT RNB-like domain-containing protein
OS=Cryptosporidium muris RN66 GN=CMU_011660 PE=4 SV=1
Length = 975

Score = 33.1 bits (74), Expect = 7.1
Identities = 18/59 (30%), Positives = 28/59 (47%)
Frame = +3

Query: 192 FIPGSTIY*LFQS*MRHRQALALLYPTLSKDR*ERQSPFPLQLIYACLLFQGCRTDTTI 368
F+P +Y L + +R+ LL P S ++ P PL ++Y C + QG T I
Sbjct: 193 FVPLLKVYPLIKIHLRNSVIKKLLAPFTSNINDTKKIPIPLNILYTCNILQGTSTSRYI 251