BP914723
Clone id YMU001_000062_B10
Library
Length 582
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000062_B10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACTAAAGGGACTAGTCCTGCAGGTTAAACGAATCGCCCTTGAGATATTACCTGCAGGTA
CTCAACTGGAAAAATCCTGCGGCCGCAGGAAATTCTTCAGCAGGATCAAAATCCTGTTCT
TTTTTCCCCCAATCTAAGCTCCAATTTCTGTTAATGTCCACCCCTCTTCCATTTTTCCGC
TCGCACAAGTGTCCATTCTCCACTATCTTGCGTCCATTATAGTTCTCCAAGGGTATTATC
TTTATAATCAGCTTTTGCAGCAGCGATCCTGATTTTCACATTGTTAAAAACGGCAGGTTC
TTTTTCACCAACCAGAATTCTGAGAAGCCTCAAGGCAACTTCACTTGTGATCAGCTCCCT
ACCATGCTGCCCAAAACTCAGCAAAAGCCTGTACTTCTTCTTCTCCACTTTTATATTGCT
ACGATGCTCGACTGTTGCAACCAAAATTTCGCTACTGTAGCCATCAACTTCTGATTTCCA
AGATTCAACCAACATGCTCTGTGGATGCCTAAAGGCAAGGGCTTCAATTTCTTGAAGCAA
AGCATCTCTTTGATGGTAAAGATCTGTGTCTATCTGGGTGAT
■■Homology search results ■■ -
sp_hit_id P24894
Definition sp|P24894|COX2_CAEEL Cytochrome c oxidase subunit 2 OS=Caenorhabditis elegans
Align length 47
Score (bit) 31.6
E-value 2.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914723|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_B10.
(541 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P24894|COX2_CAEEL Cytochrome c oxidase subunit 2 OS=Caenorhab... 32 2.6
sp|P24882|COX2_ASCSU Cytochrome c oxidase subunit 2 OS=Ascaris s... 30 5.8
sp|P08133|ANXA6_HUMAN Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3 30 5.8
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 30 7.6
sp|P14824|ANXA6_MOUSE Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2 30 7.6
sp|Q89AG5|YHIT_BUCBP Uncharacterized HIT-like protein bbp_327 OS... 30 9.9
sp|Q8SEM9|COX2_CAERE Cytochrome c oxidase subunit 2 (Fragment) O... 30 9.9
sp|Q8HEC3|COX2_CAEBR Cytochrome c oxidase subunit 2 OS=Caenorhab... 30 9.9
sp|P18143|CBPS_STRGR Zinc carboxypeptidase OS=Streptomyces grise... 30 9.9

>sp|P24894|COX2_CAEEL Cytochrome c oxidase subunit 2
OS=Caenorhabditis elegans GN=cox-2 PE=3 SV=2
Length = 231

Score = 31.6 bits (70), Expect = 2.6
Identities = 16/47 (34%), Positives = 23/47 (48%)
Frame = +2

Query: 251 GRFFFTNQNSEKPQGNFTCDQLPTMLPKTQQKPVLLLLHFYIATMLD 391
G F+F ++ E G C PT++ Q P L LL++Y LD
Sbjct: 49 GTFYFKSKKIEYQFGELLCSIFPTIILLMQMVPSLSLLYYYGLMNLD 95


>sp|P24882|COX2_ASCSU Cytochrome c oxidase subunit 2 OS=Ascaris suum
GN=COII PE=3 SV=2
Length = 232

Score = 30.4 bits (67), Expect = 5.8
Identities = 15/45 (33%), Positives = 22/45 (48%)
Frame = +2

Query: 257 FFFTNQNSEKPQGNFTCDQLPTMLPKTQQKPVLLLLHFYIATMLD 391
F+F ++ E G C PT++ Q P L LL++Y LD
Sbjct: 51 FYFKSKKIEYQFGELLCSVFPTLILVMQMVPSLSLLYYYGLMNLD 95


>sp|P08133|ANXA6_HUMAN Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3
Length = 673

Score = 30.4 bits (67), Expect = 5.8
Identities = 27/118 (22%), Positives = 56/118 (47%), Gaps = 1/118 (0%)
Frame = -1

Query: 421 GYSSEILVATVEHRSNIKVEKKKYRLLLSFGQHGRELITSEVALRLLRILVG-EKEPAVF 245
G + ++ + HRSN++ ++ + FG+ + SE++ L R+++G PA +
Sbjct: 380 GTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSEISGDLARLILGLMMPPAHY 439

Query: 244 NNVKIRIAAAKADYKDNTLGEL*WTQDSGEWTLVRAEKWKRGGH*QKLELRLGEKRTG 71
+ +++ A A + L E+ T+ + E + E +K H + LE L +G
Sbjct: 440 DAKQLKKAMEGAGTDEKALIEILATRTNAEIRAIN-EAYKEDYH-KSLEDALSSDTSG 495


>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 30.0 bits (66), Expect = 7.6
Identities = 21/79 (26%), Positives = 42/79 (53%)
Frame = -1

Query: 526 TDLYHQRDALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVEKKKYR 347
T Y + ++EI+A + + +VE V Y+S +L+ V +S+ +KKK+R
Sbjct: 317 TKNYRSPHSQVEEIQAQVQKLIKDKIVEP---SVSQYNSPLLL--VPKKSSPNSDKKKWR 371

Query: 346 LLLSFGQHGRELITSEVAL 290
L++ + Q ++L+ + L
Sbjct: 372 LVIDYRQINKKLLADKFPL 390


>sp|P14824|ANXA6_MOUSE Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2
Length = 673

Score = 30.0 bits (66), Expect = 7.6
Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 1/118 (0%)
Frame = -1

Query: 421 GYSSEILVATVEHRSNIKVEKKKYRLLLSFGQHGRELITSEVALRLLRILVG-EKEPAVF 245
G ++ V HRSN + ++ + FG+ + SE++ L R+++G PA +
Sbjct: 380 GTDEATIIDIVTHRSNAQRQQIRQTFKSHFGRDLMADLKSEISGDLARLILGLMMPPAHY 439

Query: 244 NNVKIRIAAAKADYKDNTLGEL*WTQDSGEWTLVRAEKWKRGGH*QKLELRLGEKRTG 71
+ +++ A A + TL E+ T+ + E + E +K H + LE L +G
Sbjct: 440 DAKQLKKAMEGAGTDEKTLIEILATRTNAEIRAIN-EAYKEDYH-KSLEDALSSDTSG 495


>sp|Q89AG5|YHIT_BUCBP Uncharacterized HIT-like protein bbp_327
OS=Buchnera aphidicola subsp. Baizongia pistaciae
GN=bbp_327 PE=4 SV=1
Length = 112

Score = 29.6 bits (65), Expect = 9.9
Identities = 15/49 (30%), Positives = 28/49 (57%)
Frame = -1

Query: 406 ILVATVEHRSNIKVEKKKYRLLLSFGQHGRELITSEVALRLLRILVGEK 260
+L +++ K++K YRL+++ QHGR+ E+ L +L G+K
Sbjct: 64 MLYISIKIAKKFKIDKNGYRLIINCNQHGRQ----EIQHLHLHLLGGKK 108


>sp|Q8SEM9|COX2_CAERE Cytochrome c oxidase subunit 2 (Fragment)
OS=Caenorhabditis remanei GN=cox-2 PE=3 SV=1
Length = 230

Score = 29.6 bits (65), Expect = 9.9
Identities = 15/45 (33%), Positives = 22/45 (48%)
Frame = +2

Query: 257 FFFTNQNSEKPQGNFTCDQLPTMLPKTQQKPVLLLLHFYIATMLD 391
F+F ++ E G C PT++ Q P L LL++Y LD
Sbjct: 50 FYFKSKKIEYQFGELLCSIFPTIILLMQMVPSLSLLYYYGLMNLD 94


>sp|Q8HEC3|COX2_CAEBR Cytochrome c oxidase subunit 2
OS=Caenorhabditis briggsae GN=cox-2 PE=3 SV=1
Length = 231

Score = 29.6 bits (65), Expect = 9.9
Identities = 15/45 (33%), Positives = 22/45 (48%)
Frame = +2

Query: 257 FFFTNQNSEKPQGNFTCDQLPTMLPKTQQKPVLLLLHFYIATMLD 391
F+F ++ E G C PT++ Q P L LL++Y LD
Sbjct: 51 FYFKSKKIEYQFGELLCSIFPTIILLMQMVPSLSLLYYYGLMNLD 95


>sp|P18143|CBPS_STRGR Zinc carboxypeptidase OS=Streptomyces griseus
GN=scpD PE=1 SV=2
Length = 451

Score = 29.6 bits (65), Expect = 9.9
Identities = 16/43 (37%), Positives = 25/43 (58%)
Frame = -1

Query: 400 VATVEHRSNIKVEKKKYRLLLSFGQHGRELITSEVALRLLRIL 272
V V+ N+ ++ + +L + QH RE +T E+AL LLR L
Sbjct: 167 VIAVKVSDNVATDEAEPEVLFTAHQHAREHLTVEMALYLLREL 209


tr_hit_id Q6YUT3
Definition tr|Q6YUT3|Q6YUT3_ORYSJ Os02g0119300 protein OS=Oryza sativa subsp. japonica
Align length 97
Score (bit) 86.3
E-value 8.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914723|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_B10.
(541 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6YUT3|Q6YUT3_ORYSJ Os02g0119300 protein OS=Oryza sativa subs... 86 8e-31
tr|A3A2I1|A3A2I1_ORYSJ Putative uncharacterized protein OS=Oryza... 86 8e-31
tr|A7QPB1|A7QPB1_VITVI Chromosome chr18 scaffold_137, whole geno... 83 2e-30
tr|B8AGJ1|B8AGJ1_ORYSI Putative uncharacterized protein OS=Oryza... 75 2e-27
tr|Q9FGZ7|Q9FGZ7_ARATH Arabidopsis thaliana genomic DNA, chromos... 72 3e-26
tr|A8JA31|A8JA31_CHLRE Predicted protein OS=Chlamydomonas reinha... 68 5e-22
tr|A4S0Z7|A4S0Z7_OSTLU Predicted protein OS=Ostreococcus lucimar... 58 2e-13
tr|A0E2V6|A0E2V6_PARTE Chromosome undetermined scaffold_75, whol... 37 5e-06
tr|A0BKQ4|A0BKQ4_PARTE Chromosome undetermined scaffold_112, who... 37 9e-06
tr|A0C772|A0C772_PARTE Chromosome undetermined scaffold_154, who... 43 2e-05
tr|A0BDE6|A0BDE6_PARTE Chromosome undetermined scaffold_100, who... 39 9e-05
tr|A0BWR0|A0BWR0_PARTE Chromosome undetermined scaffold_132, who... 38 3e-04
tr|A9UUQ9|A9UUQ9_MONBE Predicted protein OS=Monosiga brevicollis... 34 0.001
tr|B6KIZ5|B6KIZ5_TOXGO Putative uncharacterized protein OS=Toxop... 32 0.003
tr|A0C974|A0C974_PARTE Chromosome undetermined scaffold_16, whol... 33 0.008
tr|B6M1E6|B6M1E6_BRAFL Putative uncharacterized protein OS=Branc... 36 0.012
tr|Q098W0|Q098W0_STIAU Molting fluid carboxypeptidase A, putativ... 33 0.027
tr|B3S6G2|B3S6G2_TRIAD Putative uncharacterized protein OS=Trich... 32 0.097
tr|A7PF31|A7PF31_VITVI Chromosome chr11 scaffold_13, whole genom... 38 0.30
tr|A8JB30|A8JB30_CHLRE Predicted protein OS=Chlamydomonas reinha... 38 0.39
tr|B3P7C9|B3P7C9_DROER GG12438 OS=Drosophila erecta GN=GG12438 P... 32 0.96
tr|Q9VCM8|Q9VCM8_DROME CG4408 OS=Drosophila melanogaster GN=CG44... 31 1.2
tr|Q7JVX3|Q7JVX3_DROME LD41739p OS=Drosophila melanogaster GN=CG... 31 1.2
tr|A4C8L3|A4C8L3_9GAMM Predicted carboxypeptidase OS=Pseudoalter... 35 2.0
tr|B4MLT6|B4MLT6_DROWI GK16802 OS=Drosophila willistoni GN=GK168... 33 2.7
tr|Q2RI79|Q2RI79_MOOTA N-terminal methylation OS=Moorella thermo... 34 4.4
tr|A7RZS2|A7RZS2_NEMVE Predicted protein OS=Nematostella vectens... 34 4.4
tr|B3LYA0|B3LYA0_DROAN GF18768 OS=Drosophila ananassae GN=GF1876... 29 5.7
tr|Q65KC1|Q65KC1_BACLD Peptidase M24,putative metallopetidase OS... 34 5.7
tr|Q82I92|Q82I92_STRAW Putative secreted zinc-binding carboxypep... 33 7.4

>tr|Q6YUT3|Q6YUT3_ORYSJ Os02g0119300 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0088N06.2 PE=2 SV=1
Length = 435

Score = 86.3 bits (212), Expect(2) = 8e-31
Identities = 43/97 (44%), Positives = 60/97 (61%)
Frame = -1

Query: 541 ITQIDTDLYHQRDALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVE 362
+T I LYH D+LL +I+AL RHP + +++ + GYS+++ + T H
Sbjct: 38 VTPISRTLYHSSDSLLSDIKALVARHPDKLSMDTITASNKGYSTDLFIVTFNHAKESTSN 97

Query: 361 KKKYRLLLSFGQHGRELITSEVALRLLRILVGEKEPA 251
K +LLSFGQHGRELITSEVAL LL IL +++ A
Sbjct: 98 SSKIHVLLSFGQHGRELITSEVALNLLYILTEKRKIA 134



Score = 71.2 bits (173), Expect(2) = 8e-31
Identities = 29/38 (76%), Positives = 34/38 (89%)
Frame = -2

Query: 186 ENYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKKEQ 73
EN NGRK VE G LC+R+NGRGVD+NRNWS+DWGKKE+
Sbjct: 156 ENLNGRKRVEEGELCDRRNGRGVDLNRNWSVDWGKKEK 193


>tr|A3A2I1|A3A2I1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005003 PE=4 SV=1
Length = 417

Score = 86.3 bits (212), Expect(2) = 8e-31
Identities = 43/97 (44%), Positives = 60/97 (61%)
Frame = -1

Query: 541 ITQIDTDLYHQRDALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVE 362
+T I LYH D+LL +I+AL RHP + +++ + GYS+++ + T H
Sbjct: 20 VTPISRTLYHSSDSLLSDIKALVARHPDKLSMDTITASNKGYSTDLFIVTFNHAKESTSN 79

Query: 361 KKKYRLLLSFGQHGRELITSEVALRLLRILVGEKEPA 251
K +LLSFGQHGRELITSEVAL LL IL +++ A
Sbjct: 80 SSKIHVLLSFGQHGRELITSEVALNLLYILTEKRKIA 116



Score = 71.2 bits (173), Expect(2) = 8e-31
Identities = 29/38 (76%), Positives = 34/38 (89%)
Frame = -2

Query: 186 ENYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKKEQ 73
EN NGRK VE G LC+R+NGRGVD+NRNWS+DWGKKE+
Sbjct: 138 ENLNGRKRVEEGELCDRRNGRGVDLNRNWSVDWGKKEK 175


>tr|A7QPB1|A7QPB1_VITVI Chromosome chr18 scaffold_137, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002874001
PE=4 SV=1
Length = 436

Score = 82.8 bits (203), Expect(2) = 2e-30
Identities = 42/93 (45%), Positives = 59/93 (63%)
Frame = -1

Query: 538 TQIDTDLYHQRDALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVEK 359
T I+ DLYH L++EI L RHP +E+ ++ GY +E+ V T ++
Sbjct: 39 TPINGDLYHSSGLLMEEISNLVHRHPDKFTMETIETGNQGYKAEVTVVTYCRNRKEIDDR 98

Query: 358 KKYRLLLSFGQHGRELITSEVALRLLRILVGEK 260
K+R+LLSFGQHGRELITSE+ALR+L +L E+
Sbjct: 99 SKFRILLSFGQHGRELITSELALRVLSVLSEEQ 131



Score = 73.6 bits (179), Expect(2) = 2e-30
Identities = 30/38 (78%), Positives = 35/38 (92%)
Frame = -2

Query: 186 ENYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKKEQ 73
EN NGRK+VE G LCER+NGRGVD+NRNWS+DWGKKE+
Sbjct: 156 ENLNGRKLVEAGELCERRNGRGVDLNRNWSVDWGKKEK 193


>tr|B8AGJ1|B8AGJ1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05610 PE=4 SV=1
Length = 397

Score = 75.1 bits (183), Expect(2) = 2e-27
Identities = 38/85 (44%), Positives = 53/85 (62%)
Frame = -1

Query: 505 DALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVEKKKYRLLLSFGQ 326
D+LL +I+AL RHP + +++ + GYS+ + + T H K +LLSFGQ
Sbjct: 12 DSLLSDIKALVARHPDKLSMDTITASNKGYSTHLFIVTFNHAKESTSNSSKIHVLLSFGQ 71

Query: 325 HGRELITSEVALRLLRILVGEKEPA 251
HGRELITSEVAL LL IL +++ A
Sbjct: 72 HGRELITSEVALNLLYILTEKRKIA 96



Score = 71.2 bits (173), Expect(2) = 2e-27
Identities = 29/38 (76%), Positives = 34/38 (89%)
Frame = -2

Query: 186 ENYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKKEQ 73
EN NGRK VE G LC+R+NGRGVD+NRNWS+DWGKKE+
Sbjct: 118 ENLNGRKRVEEGELCDRRNGRGVDLNRNWSVDWGKKEK 155


>tr|Q9FGZ7|Q9FGZ7_ARATH Arabidopsis thaliana genomic DNA, chromosome
5, TAC clone:K5J14 OS=Arabidopsis thaliana GN=At5g42320
PE=4 SV=1
Length = 461

Score = 72.0 bits (175), Expect(2) = 3e-26
Identities = 36/82 (43%), Positives = 53/82 (64%)
Frame = -1

Query: 505 DALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVEKKKYRLLLSFGQ 326
D L+++I +L RHP + +E KS GY++E+ V T ++ +R+LL+FGQ
Sbjct: 80 DDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVVTYCRGGKESDDRSNFRILLTFGQ 139

Query: 325 HGRELITSEVALRLLRILVGEK 260
HGRELITSE+A R+L IL E+
Sbjct: 140 HGRELITSELAFRILSILSEEQ 161



Score = 70.1 bits (170), Expect(2) = 3e-26
Identities = 29/38 (76%), Positives = 34/38 (89%)
Frame = -2

Query: 186 ENYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKKEQ 73
EN NGRK VE+G LCER+NGRGVD+NRNW +DWGKKE+
Sbjct: 186 ENPNGRKRVESGDLCERRNGRGVDLNRNWGVDWGKKEK 223


>tr|A8JA31|A8JA31_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_177379 PE=4 SV=1
Length = 431

Score = 67.8 bits (164), Expect(2) = 5e-22
Identities = 28/37 (75%), Positives = 32/37 (86%)
Frame = -2

Query: 186 ENYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKKE 76
EN GRK+VE+G +CERKNGRGVD NRNW LDWG+KE
Sbjct: 173 ENEGGRKLVESGKMCERKNGRGVDPNRNWPLDWGRKE 209



Score = 60.1 bits (144), Expect(2) = 5e-22
Identities = 33/92 (35%), Positives = 51/92 (55%)
Frame = -1

Query: 535 QIDTDLYHQRDALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVEKK 356
Q D +YH R+ LL+++ + +P M E ++ Y +E+ V TVE K
Sbjct: 49 QPDYSIYHTREDLLKQVADIVAANPSFMKEEVLSAKDGNYGAELKVVTVEP-GGFTDRKD 107

Query: 355 KYRLLLSFGQHGRELITSEVALRLLRILVGEK 260
K +LL FG+HGRE I+SE+ L L+R L ++
Sbjct: 108 KVHMLLDFGEHGREFISSELGLLLMRTLADKE 139


>tr|A4S0Z7|A4S0Z7_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_42459 PE=4 SV=1
Length = 356

Score = 57.8 bits (138), Expect(2) = 2e-13
Identities = 24/36 (66%), Positives = 28/36 (77%)
Frame = -2

Query: 186 ENYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKK 79
EN GR++VE G CERKNGRGVD NRNW ++WG K
Sbjct: 98 ENERGRELVERGDPCERKNGRGVDPNRNWGVNWGVK 133



Score = 40.8 bits (94), Expect(2) = 2e-13
Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
Frame = -1

Query: 454 MLVESWKSEVDGYSSEILVATVE-HRSNIKVEKKKYRLLLSFGQHGRELITSEVALRLLR 278
M E+ + DGY + + V ++ + + K R+LL++G+HGREL+ + A+RLL
Sbjct: 1 MTTETREDATDGYRARVDVVYARLSGADAREDGDKLRVLLNYGEHGRELVPVDAAVRLLE 60

Query: 277 ILVGEKEPAV 248
+ E E AV
Sbjct: 61 TM-AEGEDAV 69


>tr|A0E2V6|A0E2V6_PARTE Chromosome undetermined scaffold_75, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00022795001 PE=4 SV=1
Length = 356

Score = 37.0 bits (84), Expect(2) = 5e-06
Identities = 16/30 (53%), Positives = 19/30 (63%)
Frame = -2

Query: 171 RKIVENGHLCERKNGRGVDINRNWSLDWGK 82
R+ VE G C R+N GVDINRN+ W K
Sbjct: 122 RQKVEGGEYCLRENENGVDINRNYDAHWEK 151



Score = 36.6 bits (83), Expect(2) = 5e-06
Identities = 29/86 (33%), Positives = 40/86 (46%)
Frame = -1

Query: 517 YHQRDALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVEKKKYRLLL 338
YH L +E+E+L+ S L + S L+ V SN + KKYR +
Sbjct: 23 YHTTAELNEELESLS--RSCSFL------SLSNASDSPLIKEVNINSN---QNKKYRAYI 71

Query: 337 SFGQHGRELITSEVALRLLRILVGEK 260
FG+H RELI+ E + L L EK
Sbjct: 72 LFGEHPRELISPESGIHFLNDLCFEK 97


>tr|A0BKQ4|A0BKQ4_PARTE Chromosome undetermined scaffold_112, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00029752001 PE=4 SV=1
Length = 357

Score = 37.0 bits (84), Expect(2) = 9e-06
Identities = 16/30 (53%), Positives = 19/30 (63%)
Frame = -2

Query: 171 RKIVENGHLCERKNGRGVDINRNWSLDWGK 82
R+ VE G C R+N GVDINRN+ W K
Sbjct: 122 RQKVEGGEYCLRENENGVDINRNYDAHWEK 151



Score = 35.8 bits (81), Expect(2) = 9e-06
Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 4/102 (3%)
Frame = -1

Query: 517 YHQRDALLQEIEALAFRHPQSMLVESWKSEVDGYSSEILVATVEHRSNIKVEKKKYRLLL 338
YH L +E+E+L+ +S S + D S +I + N KKYR +
Sbjct: 23 YHTTAELNEELESLS----RSCSFLSLSNASD--SPQIKEVNINRNQN-----KKYRAYI 71

Query: 337 SFGQHGRELITSEVALRLLRILVGE----KEPAVFNNVKIRI 224
FG+H RELI+ E + L L E K + +N ++R+
Sbjct: 72 LFGEHPRELISPESGIHFLNDLCYEKTDPKNQQILDNFELRL 113


>tr|A0C772|A0C772_PARTE Chromosome undetermined scaffold_154, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00035769001 PE=4 SV=1
Length = 316

Score = 43.1 bits (100), Expect(2) = 2e-05
Identities = 18/36 (50%), Positives = 23/36 (63%)
Frame = -2

Query: 183 NYNGRKIVENGHLCERKNGRGVDINRNWSLDWGKKE 76
N R+ VE GH C R+N GVD+NRN+ +W KE
Sbjct: 109 NPTSRRYVERGHYCLRENLNGVDLNRNYGFEWKFKE 144



Score = 28.9 bits (63), Expect(2) = 2e-05
Identities = 13/27 (48%), Positives = 17/27 (62%)
Frame = -1

Query: 361 KKKYRLLLSFGQHGRELITSEVALRLL 281
+ K + L FG+H RELI+ E L LL
Sbjct: 64 ENKNKAFLIFGEHARELISVETGLHLL 90