BP914725
Clone id YMU001_000062_B12
Library
Length 298
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000062_B12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTTTTTTTTCAATAAATGTAGTGGTTGTTAACTTGGATACACAGAGTAACAT
ACACAGCAAATGCTCCAATTGGATGCTTTGCAATCACTATATGTTCATTTACAATCAATA
TACAGAGGTAAATCTCAATTTGTAGGCAAGTGGTTGTCCACCTTTCCTTTAAAAGAGCAT
AAGAGGGCAATTAACTGGTGCCCTCCTTGGACAAAAGGCAAGAATGAACTTCACTTTTCA
CAATACAAAATTGTCAACAATATGGGCAATGACATCTGCTCCCTCAGAGTGCATCCAA
■■Homology search results ■■ -
sp_hit_id Q86SP6
Definition sp|Q86SP6|GP149_HUMAN Probable G-protein coupled receptor 149 OS=Homo sapiens
Align length 53
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914725|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_B12.
(281 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q86SP6|GP149_HUMAN Probable G-protein coupled receptor 149 OS... 30 2.9
sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate... 29 8.3
sp|Q9BY44|EIF2A_HUMAN Eukaryotic translation initiation factor 2... 29 8.3

>sp|Q86SP6|GP149_HUMAN Probable G-protein coupled receptor 149
OS=Homo sapiens GN=GPR149 PE=2 SV=2
Length = 731

Score = 30.4 bits (67), Expect = 2.9
Identities = 18/53 (33%), Positives = 24/53 (45%)
Frame = -3

Query: 264 EQMSLPILLTILYCEK*SSFLPFVQGGHQLIALLCSFKGKVDNHLPTN*DLPL 106
E+ P L +C S P + G+ L LC+F+G V H PT L L
Sbjct: 518 EESQKPDLSDWEWCRSKSERTPRQRSGYALAIPLCAFQGTVSLHAPTGKTLSL 570


>sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15
OS=Homo sapiens GN=EPS15 PE=1 SV=2
Length = 896

Score = 28.9 bits (63), Expect = 8.3
Identities = 19/66 (28%), Positives = 26/66 (39%)
Frame = +2

Query: 71 LQSLYVHLQSIYRGKSQFVGKWLSTFPLKEHKRAINWCPPWTKGKNELHFSQYKIVNNMG 250
L+ L HLQ + S K + L+ H +NWC S + I+ N
Sbjct: 475 LEPLQQHLQDSQQEISSMQMKLMEMKDLENHNSQLNWCS-----------SPHSILVNGA 523

Query: 251 NDICSL 268
D CSL
Sbjct: 524 TDYCSL 529


>sp|Q9BY44|EIF2A_HUMAN Eukaryotic translation initiation factor 2A
OS=Homo sapiens GN=EIF2A PE=1 SV=3
Length = 585

Score = 28.9 bits (63), Expect = 8.3
Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 8/40 (20%)
Frame = +2

Query: 164 KRAINWCPPWTKGK--------NELHFSQYKIVNNMGNDI 259
K+ NWCP W++ + NE+HF + N + N +
Sbjct: 126 KKMQNWCPSWSEDETLCARNVNNEVHFFENNNFNTIANKL 165


tr_hit_id Q6H6H9
Definition tr|Q6H6H9|Q6H6H9_ORYSJ Putative uncharacterized protein P0519E06.12-1 (Putative uncharacterized protein OJ1003_B06.28-1) OS=Oryza sativa subsp. japonica
Align length 18
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914725|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_B12.
(281 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6H6H9|Q6H6H9_ORYSJ Putative uncharacterized protein P0519E06... 34 3.2
tr|B8AG36|B8AG36_ORYSI Putative uncharacterized protein OS=Oryza... 34 3.2
tr|A3A9R4|A3A9R4_ORYSJ Putative uncharacterized protein OS=Oryza... 34 3.2
tr|B6TDR9|B6TDR9_MAIZE Serine esterase family protein OS=Zea may... 34 4.2
tr|Q0J5C0|Q0J5C0_ORYSJ Os08g0447300 protein OS=Oryza sativa subs... 33 7.2
tr|B8A2Q7|B8A2Q7_MAIZE Putative uncharacterized protein OS=Zea m... 33 7.2
tr|B6SYS8|B6SYS8_MAIZE Serine esterase family protein OS=Zea may... 33 7.2

>tr|Q6H6H9|Q6H6H9_ORYSJ Putative uncharacterized protein
P0519E06.12-1 (Putative uncharacterized protein
OJ1003_B06.28-1) OS=Oryza sativa subsp. japonica
GN=P0519E06.12-1 PE=4 SV=1
Length = 72

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/18 (77%), Positives = 17/18 (94%)
Frame = -2

Query: 277 MHSEGADVIAHIVDNFVL 224
MHSEGADVI H++D+FVL
Sbjct: 55 MHSEGADVINHMIDHFVL 72


>tr|B8AG36|B8AG36_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08326 PE=4 SV=1
Length = 352

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/18 (77%), Positives = 17/18 (94%)
Frame = -2

Query: 277 MHSEGADVIAHIVDNFVL 224
MHSEGADVI H++D+FVL
Sbjct: 335 MHSEGADVINHMIDHFVL 352


>tr|A3A9R4|A3A9R4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007536 PE=4 SV=1
Length = 183

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/18 (77%), Positives = 17/18 (94%)
Frame = -2

Query: 277 MHSEGADVIAHIVDNFVL 224
MHSEGADVI H++D+FVL
Sbjct: 166 MHSEGADVINHMIDHFVL 183


>tr|B6TDR9|B6TDR9_MAIZE Serine esterase family protein OS=Zea mays
PE=2 SV=1
Length = 345

Score = 33.9 bits (76), Expect = 4.2
Identities = 13/18 (72%), Positives = 16/18 (88%)
Frame = -2

Query: 277 MHSEGADVIAHIVDNFVL 224
MHSEGADVI H++D F+L
Sbjct: 328 MHSEGADVIQHMIDQFIL 345


>tr|Q0J5C0|Q0J5C0_ORYSJ Os08g0447300 protein OS=Oryza sativa subsp.
japonica GN=Os08g0447300 PE=4 SV=1
Length = 359

Score = 33.1 bits (74), Expect = 7.2
Identities = 11/19 (57%), Positives = 18/19 (94%)
Frame = -2

Query: 280 WMHSEGADVIAHIVDNFVL 224
W++S+GADVI H++DNF++
Sbjct: 341 WLNSDGADVINHMMDNFIV 359


>tr|B8A2Q7|B8A2Q7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 139

Score = 33.1 bits (74), Expect = 7.2
Identities = 11/19 (57%), Positives = 18/19 (94%)
Frame = -2

Query: 280 WMHSEGADVIAHIVDNFVL 224
W++S+GADVI H++DNF++
Sbjct: 121 WLNSDGADVINHMMDNFIV 139


>tr|B6SYS8|B6SYS8_MAIZE Serine esterase family protein OS=Zea mays
PE=2 SV=1
Length = 430

Score = 33.1 bits (74), Expect = 7.2
Identities = 11/19 (57%), Positives = 18/19 (94%)
Frame = -2

Query: 280 WMHSEGADVIAHIVDNFVL 224
W++S+GADVI H++DNF++
Sbjct: 412 WLNSDGADVINHMMDNFIV 430