BP914734
Clone id YMU001_000062_C10
Library
Length 490
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000062_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCTATAAATAGATCATATTCCTCTTTTTAAAAATGATCTCCACACTATTTCTCAGTACTT
TGAGGCGTACCATTTGCATCTTAGTTATAGGGAGAGAGAGTGAGCTCTCTACCTACCATT
ACTTTTGGTGTATAAGAAAACTTCTTTGAGCTAGTTGTAGCATTGCAAGGGAGTGAGTGA
TACGTAACTTCCAATCAATGTTGTACATACTCTTGCACATCAATTCAATCAATAAATTGG
ATGCTACAGTGGTTCAAAACTCTCTTGAGTCTCTCCAATTCATGCTTGGAAACCTCATCT
CATTTGGTTTAGGTGACGCGTTTTCATTTTGAGATTCTTCTGTAGTATTTGCTTGTATGT
GACTCAAGAGCTCGTGTGTTTGTTTTTTGTTGCTTGCGAAAACATTATATGAGGGTTGTA
TGGTGAGAGGATTCCCATAACCCTAAGATAATGTATATATCACAACATCATCAAACTTAA
TTGTGTCTCT
■■Homology search results ■■ -
sp_hit_id P48970
Definition sp|P48970|UNIV_STRPU Univin OS=Strongylocentrotus purpuratus
Align length 43
Score (bit) 32.0
E-value 1.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914734|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_C10.
(490 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P48970|UNIV_STRPU Univin OS=Strongylocentrotus purpuratus PE=... 32 1.6
sp|P57152|SECE_BUCAI Preprotein translocase subunit secE OS=Buch... 31 3.5
sp|Q8XHI3|AMPA_CLOPE Probable cytosol aminopeptidase OS=Clostrid... 30 7.8

>sp|P48970|UNIV_STRPU Univin OS=Strongylocentrotus purpuratus PE=2
SV=2
Length = 395

Score = 32.0 bits (71), Expect = 1.6
Identities = 16/43 (37%), Positives = 23/43 (53%)
Frame = -1

Query: 469 DVVIYTLS*GYGNPLTIQPSYNVFASNKKQTHELLSHIQANTT 341
DVV+ LS GY + I + N + S K H LL H++ +T
Sbjct: 186 DVVLADLSQGYAGTIDILSTVNSWRSKKTSNHGLLLHVELMST 228


>sp|P57152|SECE_BUCAI Preprotein translocase subunit secE
OS=Buchnera aphidicola subsp. Acyrthosiphon pisum
GN=secE PE=3 SV=1
Length = 127

Score = 30.8 bits (68), Expect = 3.5
Identities = 11/25 (44%), Positives = 17/25 (68%)
Frame = +2

Query: 323 FILRFFCSICLYVTQELVCLFFVAC 397
FIL FF ++C Y TQ + +F ++C
Sbjct: 26 FILSFFINMCFYETQLFIRIFIISC 50


>sp|Q8XHI3|AMPA_CLOPE Probable cytosol aminopeptidase OS=Clostridium
perfringens GN=pepA PE=3 SV=1
Length = 493

Score = 29.6 bits (65), Expect = 7.8
Identities = 20/75 (26%), Positives = 34/75 (45%)
Frame = -1

Query: 412 SYNVFASNKKQTHELLSHIQANTTEESQNENASPKPNEMRFPSMNWRDSREF*TTVASNL 233
S+N + S+KK+ E+ HI + E + E +E S +R+ A+N+
Sbjct: 131 SFNKYKSDKKEEVEVTVHIGGHNINEEEVELCEKAIDEAMLLSETTCLARDLVNEPANNM 190

Query: 232 LIELMCKSMYNIDWK 188
E + K + NI K
Sbjct: 191 YPETLAKEVKNIGSK 205


tr_hit_id B6A9L3
Definition tr|B6A9L3|B6A9L3_9CRYT HEAT repeat family protein OS=Cryptosporidium muris RN66
Align length 103
Score (bit) 36.2
E-value 0.84
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914734|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_C10.
(490 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6A9L3|B6A9L3_9CRYT HEAT repeat family protein OS=Cryptospori... 36 0.84
tr|B6NPN8|B6NPN8_BRAFL Putative uncharacterized protein OS=Branc... 34 3.2
tr|Q804H5|Q804H5_XENLA Nlo OS=Xenopus laevis PE=2 SV=1 33 7.1
tr|Q23R43|Q23R43_TETTH Putative uncharacterized protein OS=Tetra... 33 7.1
tr|Q22YH5|Q22YH5_TETTH Zinc finger protein (Fragment) OS=Tetrahy... 33 7.1

>tr|B6A9L3|B6A9L3_9CRYT HEAT repeat family protein OS=Cryptosporidium
muris RN66 GN=CMU_039730 PE=4 SV=1
Length = 1745

Score = 36.2 bits (82), Expect = 0.84
Identities = 28/103 (27%), Positives = 51/103 (49%)
Frame = -1

Query: 430 PLTIQPSYNVFASNKKQTHELLSHIQANTTEESQNENASPKPNEMRFPSMNWRDSREF*T 251
PL+++ + +N +T +S + +N+ ++ N S K ++ S ++ D E
Sbjct: 1097 PLSLKNG-RIIETNYCKTEFGISFVTSNSNQQLMNFKESDKESDENIES-DYSDCIE--- 1151

Query: 250 TVASNLLIELMCKSMYNIDWKLRITHSLAMLQLAQRSFLIHQK 122
+SNL+ +L+C Y IDWKL + L + FL+ QK
Sbjct: 1152 --SSNLVFDLICSLYYKIDWKLGKSVILPTI----TEFLVKQK 1188


>tr|B6NPN8|B6NPN8_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_97624 PE=4 SV=1
Length = 315

Score = 34.3 bits (77), Expect = 3.2
Identities = 29/102 (28%), Positives = 39/102 (38%), Gaps = 10/102 (9%)
Frame = -1

Query: 484 TIKFDDVVIYTLS*GYGNPLTIQPSYNVFASNKKQTHELLSHIQANT----------TEE 335
T KF DV +Y L + + + N K H+ L H T
Sbjct: 10 TDKFGDVTVYVSG---DRKLRVFLTVHDIGQNHKSFHQFLLHEDMKAILSKFCIVQITVP 66

Query: 334 SQNENASPKPNEMRFPSMNWRDSREF*TTVASNLLIELMCKS 209
Q E A PN+ +FP+M +E T V +L L CKS
Sbjct: 67 GQEEGAETLPNDYKFPTM-----QEMGTEVIPQVLAALGCKS 103


>tr|Q804H5|Q804H5_XENLA Nlo OS=Xenopus laevis PE=2 SV=1
Length = 408

Score = 33.1 bits (74), Expect = 7.1
Identities = 23/60 (38%), Positives = 31/60 (51%)
Frame = -1

Query: 367 LSHIQANTTEESQNENASPKPNEMRFPSMNWRDSREF*TTVASNLLIELMCKSMYNIDWK 188
L+ +QANTT++ Q EN S + SM W R + T N+ L+C SM I WK
Sbjct: 218 LAILQANTTQD-QEENMSQC--QCPVSSMCWTFKRGYVTLYPFNIEYSLICASMLFIMWK 274


>tr|Q23R43|Q23R43_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00849410 PE=4
SV=1
Length = 1729

Score = 33.1 bits (74), Expect = 7.1
Identities = 23/65 (35%), Positives = 28/65 (43%), Gaps = 10/65 (15%)
Frame = -1

Query: 421 IQPSYNVFASNKKQTHELLSHIQANTTEESQNENASPK----------PNEMRFPSMNWR 272
+ P N FASNKKQ + L Q NT ++ NE K PNE S +
Sbjct: 757 LNPPSNKFASNKKQKLQKLQQEQNNTKGQNNNEQKDLKSLELSYNILSPNEQSIISYSQD 816

Query: 271 DSREF 257
SR F
Sbjct: 817 QSRVF 821


>tr|Q22YH5|Q22YH5_TETTH Zinc finger protein (Fragment)
OS=Tetrahymena thermophila SB210 GN=TTHERM_00607160 PE=4
SV=2
Length = 318

Score = 33.1 bits (74), Expect = 7.1
Identities = 21/70 (30%), Positives = 40/70 (57%)
Frame = -1

Query: 367 LSHIQANTTEESQNENASPKPNEMRFPSMNWRDSREF*TTVASNLLIELMCKSMYNIDWK 188
L+H Q T E+ Q++N++ + + +FPS+ D + + + +SN + E+ KS D+K
Sbjct: 207 LNHPQLQTIEDQQSQNSTTQQIDSKFPSIEQFDLKSYLSKNSSNKINEIDKKSS---DFK 263

Query: 187 LRITHSLAML 158
I +L+ L
Sbjct: 264 DSIQVTLSYL 273