BP914740
Clone id YMU001_000062_D04
Library
Length 420
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000062_D04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGGTCATTGAAGTGTATCTTGGAAGGAGGAGCAGCACTCATCCTGGCCAGATGATTGGA
GTGCAGAGCATAAAGTGGACTATTCCTTCAAGGGGACCAGTCGTAGATCCAGGAAAGAAG
CAAGGTTTTCCTTTTTCGAAGAAATCGGAGCTCTATAAGAAAGCATATGCGATGGCTGAT
GTGCTTCGAACATCTTTGTATCAGATTGTTACAACATTCAGGAAAGAAATGGTTGTGAGC
GGGCCAGGTGGGATGGCGATAGCAGAGAGGGACTGGCTTGACAAAGGGCAGCCTCTGTAT
GGCACATGTGAGTTGCACGTGCAAATTTTGCGGTTACTGCTAGACTTCAGACTCTAGTCA
TATGAGCTCTTACAGTGGTTGATTAATTACGGAAGAACTTCCTGACTCTCAAACTACTGT
■■Homology search results ■■ -
sp_hit_id Q9K6Z4
Definition sp|Q9K6Z4|HIS5_BACHD Imidazole glycerol phosphate synthase subunit hisH OS=Bacillus halodurans
Align length 41
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914740|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_D04.
(420 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9K6Z4|HIS5_BACHD Imidazole glycerol phosphate synthase subun... 32 1.3
sp|Q6NBF3|HEMH_RHOPA Ferrochelatase OS=Rhodopseudomonas palustri... 31 1.7
sp|A5CRA6|HRCA_CLAM3 Heat-inducible transcription repressor hrcA... 29 8.6

>sp|Q9K6Z4|HIS5_BACHD Imidazole glycerol phosphate synthase subunit
hisH OS=Bacillus halodurans GN=hisH PE=3 SV=1
Length = 214

Score = 31.6 bits (70), Expect = 1.3
Identities = 15/41 (36%), Positives = 24/41 (58%)
Frame = +1

Query: 208 VTTFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQIL 330
V +F M + G+ +DW+D+G+PL G C L +Q+L
Sbjct: 46 VGSFHDAMSILNETGLTAFIKDWVDEGKPLLGIC-LGMQLL 85


>sp|Q6NBF3|HEMH_RHOPA Ferrochelatase OS=Rhodopseudomonas palustris
GN=hemH PE=3 SV=1
Length = 345

Score = 31.2 bits (69), Expect = 1.7
Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 11/90 (12%)
Frame = +1

Query: 154 YKKAYAMADVLRTSLYQIVT--TFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQI 327
Y + A D L TS+ + TF E++V+ GM A ++DKG P C V+
Sbjct: 182 YYRDSAYIDALATSIKSHLASLTFEPELIVASFHGMPQA---YIDKGDPYQAQCVATVEA 238

Query: 328 LR---------LLLDFRL*SYELLQWLINY 390
LR LLL F+ + QWL Y
Sbjct: 239 LRERMGVADDKLLLTFQS-RFGFDQWLQPY 267


>sp|A5CRA6|HRCA_CLAM3 Heat-inducible transcription repressor hrcA
OS=Clavibacter michiganensis subsp. michiganensis
(strain NCPPB 382) GN=hrcA PE=3 SV=1
Length = 340

Score = 28.9 bits (63), Expect = 8.6
Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
Frame = +1

Query: 169 AMADVLRTSLYQIVTTFRKE-MVVSGPGGMAIAERDWLDKGQPLYGTCELHVQILRLL 339
A A VL +L + V R+E ++++G +A ERD+ P+ E V +LRLL
Sbjct: 209 AAASVLAGTLVEQVLANRQERLLLAGSANLARTERDFPGSISPVLEAIEEQVVLLRLL 266


tr_hit_id A9U0P8
Definition tr|A9U0P8|A9U0P8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 120
Score (bit) 132.0
E-value 7.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914740|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_D04.
(420 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9U0P8|A9U0P8_PHYPA Predicted protein OS=Physcomitrella paten... 132 7e-30
tr|A7QTZ4|A7QTZ4_VITVI Chromosome undetermined scaffold_174, who... 92 2e-17
tr|Q2M5C6|Q2M5C6_BRAJU Putative uncharacterized protein (Fragmen... 80 5e-14
tr|Q60D06|Q60D06_SOLDE Putative uncharacterized protein OS=Solan... 75 2e-12
tr|Q9CAT8|Q9CAT8_ARATH Putative uncharacterized protein T18K17.9... 72 1e-11
tr|Q8LAF4|Q8LAF4_ARATH Putative uncharacterized protein OS=Arabi... 72 1e-11
tr|Q8L628|Q8L628_ARATH Putative uncharacterized protein At1g7324... 71 3e-11
tr|B6U818|B6U818_MAIZE Putative uncharacterized protein OS=Zea m... 70 7e-11
tr|A2X8D7|A2X8D7_ORYSI Putative uncharacterized protein OS=Oryza... 69 1e-10
tr|Q6ETZ8|Q6ETZ8_ORYSJ Os02g0684300 protein OS=Oryza sativa subs... 68 2e-10
tr|A3AA67|A3AA67_ORYSJ Putative uncharacterized protein OS=Oryza... 68 2e-10
tr|B3T351|B3T351_9ZZZZ Putative uncharacterized protein OS=uncul... 36 1.1
tr|A4QWF3|A4QWF3_MAGGR Putative uncharacterized protein OS=Magna... 35 2.4
tr|Q3KGA7|Q3KGA7_PSEPF Putative uncharacterized protein OS=Pseud... 34 4.1
tr|Q1YF26|Q1YF26_MOBAS Penicillin-insensitive murein endopeptida... 33 7.0

>tr|A9U0P8|A9U0P8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_153935 PE=4 SV=1
Length = 534

Score = 132 bits (333), Expect = 7e-30
Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 2/120 (1%)
Frame = +1

Query: 1 LVIEVYLGRRSSTHPGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKKSELYKKAYAMAD 180
LV+EVYLGRRSS +G SIKWT+PS+G V D K++G PF K S ++KKAYA+AD
Sbjct: 414 LVVEVYLGRRSSARGVGFVGPNSIKWTVPSQGVVADVVKRKGSPFGKGSSMHKKAYALAD 473

Query: 181 VLRTSLYQIVTTFRKEMVVSGPG--GMAIAERDWLDKGQPLYGTCELHVQILRLLLDFRL 354
+LRTS+YQI+ F +E++V G+AIAERDWL + PLYG+ E+H+Q L L L++R+
Sbjct: 474 ILRTSIYQIIAVFGEEIMVGSISNKGLAIAERDWLSQTTPLYGSHEMHLQKLGLFLEYRV 533


>tr|A7QTZ4|A7QTZ4_VITVI Chromosome undetermined scaffold_174, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006605001 PE=4 SV=1
Length = 530

Score = 91.7 bits (226), Expect = 2e-17
Identities = 54/122 (44%), Positives = 74/122 (60%), Gaps = 5/122 (4%)
Frame = +1

Query: 1 LVIEVYLGRRSSTH-PGQMIGVQSIKW----TIPSRGPVVDPGKKQGFPFSKKSELYKKA 165
L +E +LG+++S P ++G IKW T S GKK+GFP L+ +A
Sbjct: 415 LAVETFLGKKTSLQSPNALMGPAGIKWATVTTARSDAATSVVGKKRGFP------LHSQA 468

Query: 166 YAMADVLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQILRLLLD 345
YA+ADVLRTS+Y IV+ F +EM+ G + E+DW+ G+PLYGT EL +Q L L LD
Sbjct: 469 YAIADVLRTSIYCIVSVFHEEMLTGAKAG--LLEKDWIIGGKPLYGTRELLLQKLHLFLD 526

Query: 346 FR 351
FR
Sbjct: 527 FR 528


>tr|Q2M5C6|Q2M5C6_BRAJU Putative uncharacterized protein (Fragment)
OS=Brassica juncea PE=2 SV=1
Length = 132

Score = 80.1 bits (196), Expect = 5e-14
Identities = 48/119 (40%), Positives = 72/119 (60%), Gaps = 2/119 (1%)
Frame = +1

Query: 1 LVIEVYLGRRSSTH-PGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKKS-ELYKKAYAM 174
L +E ++G++++ P Q++G SIKW S +K P K+S LY AYA+
Sbjct: 21 LAVETFMGKKNNLQSPQQLLGPASIKWATSSMV------RKDVKPIKKRSGALYSYAYAV 74

Query: 175 ADVLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQILRLLLDFR 351
+DVLR S+YQI +TFR EMV S I RDW+ +P++GT E+ +Q L+L L+F+
Sbjct: 75 SDVLRVSMYQIDSTFRDEMVSS--DRTEILGRDWIGSKKPVFGTSEMLLQKLKLFLEFQ 131


>tr|Q60D06|Q60D06_SOLDE Putative uncharacterized protein OS=Solanum
demissum GN=SDM1_56t00017 PE=4 SV=1
Length = 612

Score = 74.7 bits (182), Expect = 2e-12
Identities = 46/122 (37%), Positives = 68/122 (55%), Gaps = 5/122 (4%)
Frame = +1

Query: 1 LVIEVYLGRRSSTHPGQ-MIGVQSIKWTIPSRG----PVVDPGKKQGFPFSKKSELYKKA 165
L +E +G++++ ++ IKW + G G+++G PF Y KA
Sbjct: 497 LAVETLMGKKTNLQSSNTLMDPAGIKWATLNPGRRDSAAGMAGRRKGSPF------YAKA 550

Query: 166 YAMADVLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQILRLLLD 345
Y+MAD+L+TS+Y IV+ F EM S G + E+DW+ +PLYGT EL Q LRL LD
Sbjct: 551 YSMADILKTSIYGIVSAFYDEMSHSAKAG--LLEKDWIISSKPLYGTRELLSQKLRLFLD 608

Query: 346 FR 351
F+
Sbjct: 609 FQ 610


>tr|Q9CAT8|Q9CAT8_ARATH Putative uncharacterized protein T18K17.9
OS=Arabidopsis thaliana GN=T18K17.9 PE=4 SV=1
Length = 501

Score = 72.4 bits (176), Expect = 1e-11
Identities = 44/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)
Frame = +1

Query: 1 LVIEVYLGRRSSTH-PGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKK-SELYKKAYAM 174
L IE ++G++++ P Q++G SIKW S +K P + +Y AYA
Sbjct: 390 LAIETFMGKKTNLQSPQQLMGPASIKWATSSMV------RKDVKPIKRSIGAMYAYAYAA 443

Query: 175 ADVLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQILRLLLDFR 351
DVLR S+YQI++TFR EM+ S G + RDW+ +P +GT ++ +Q L+L L+F+
Sbjct: 444 TDVLRISVYQILSTFRDEMLNSDRAG--LLGRDWIGSKKPPFGTNDMLLQKLKLFLEFQ 500


>tr|Q8LAF4|Q8LAF4_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 519

Score = 72.4 bits (176), Expect = 1e-11
Identities = 44/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)
Frame = +1

Query: 1 LVIEVYLGRRSSTH-PGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKK-SELYKKAYAM 174
L IE ++G++++ P Q++G SIKW S +K P + +Y AYA
Sbjct: 408 LAIETFMGKKTNLQSPQQLMGPASIKWATSSMV------RKDVKPIKRSIGAMYAYAYAA 461

Query: 175 ADVLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQILRLLLDFR 351
DVLR S+YQI++TFR EM+ S G + RDW+ +P +GT ++ +Q L+L L+F+
Sbjct: 462 TDVLRISVYQILSTFRDEMLNSDRAG--LLGRDWIGSKKPPFGTNDMLLQKLKLFLEFQ 518


>tr|Q8L628|Q8L628_ARATH Putative uncharacterized protein At1g73240
OS=Arabidopsis thaliana GN=At1g73240 PE=2 SV=1
Length = 519

Score = 70.9 bits (172), Expect = 3e-11
Identities = 43/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)
Frame = +1

Query: 1 LVIEVYLGRRSSTH-PGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKK-SELYKKAYAM 174
L I+ ++G++++ P Q++G SIKW S +K P + +Y AYA
Sbjct: 408 LAIKTFMGKKTNLQSPQQLMGPASIKWATSSMV------RKDVKPIKRSIGAMYAYAYAA 461

Query: 175 ADVLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKGQPLYGTCELHVQILRLLLDFR 351
DVLR S+YQI++TFR EM+ S G + RDW+ +P +GT ++ +Q L+L L+F+
Sbjct: 462 TDVLRISVYQILSTFRDEMLNSDRAG--LLGRDWIGSKKPPFGTNDMLLQKLKLFLEFQ 518


>tr|B6U818|B6U818_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 503

Score = 69.7 bits (169), Expect = 7e-11
Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 2/119 (1%)
Frame = +1

Query: 1 LVIEVYLGRRSSTHPGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKKSELYKKAYAMAD 180
+ IE LG++++ P +G ++I+W S G G ++K L+KKAY MAD
Sbjct: 389 VAIETCLGKKTNPQPVHSLGPENIRWVNFSTGR---KGTGVAIACTQKGGLHKKAYTMAD 445

Query: 181 VLRTSLYQIVTTFRKEMVVSG-PGGMAIAERDWLDKG-QPLYGTCELHVQILRLLLDFR 351
VLRTS+YQIV+ F ++ + P + E++W+ +G +P+YG+ + VQ L L +++R
Sbjct: 446 VLRTSVYQIVSAFIDDLRANAKPSSL---EKNWISEGRKPVYGSQAVLVQKLILFIEYR 501


>tr|A2X8D7|A2X8D7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08495 PE=4 SV=1
Length = 513

Score = 68.9 bits (167), Expect = 1e-10
Identities = 38/118 (32%), Positives = 69/118 (58%), Gaps = 1/118 (0%)
Frame = +1

Query: 1 LVIEVYLGRRSSTHPGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKKSELYKKAYAMAD 180
+ +E LG++++ P +G SIKW S G G +++ L+ KA++MAD
Sbjct: 399 VAVEACLGKKTNPQPAHSLGPASIKWANFSTGR---KGNVTAIASTQRGGLHTKAFSMAD 455

Query: 181 VLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKG-QPLYGTCELHVQILRLLLDFR 351
VLRTS+YQ+V+ F +M + + E++W+ +G +P++G+ + VQ L L +++R
Sbjct: 456 VLRTSIYQMVSAFEHDMRANAKA--SSLEKNWISEGRKPVFGSQAVLVQKLSLFIEYR 511


>tr|Q6ETZ8|Q6ETZ8_ORYSJ Os02g0684300 protein OS=Oryza sativa subsp.
japonica GN=OJ1212_A08.12 PE=4 SV=1
Length = 237

Score = 68.2 bits (165), Expect = 2e-10
Identities = 37/118 (31%), Positives = 69/118 (58%), Gaps = 1/118 (0%)
Frame = +1

Query: 1 LVIEVYLGRRSSTHPGQMIGVQSIKWTIPSRGPVVDPGKKQGFPFSKKSELYKKAYAMAD 180
+ +E LG++++ P +G SIKW S G G +++ L+ KA++MAD
Sbjct: 123 VAVEACLGKKTNPQPAHSLGPASIKWANFSTGR---KGNVTAIASTQRGGLHTKAFSMAD 179

Query: 181 VLRTSLYQIVTTFRKEMVVSGPGGMAIAERDWLDKG-QPLYGTCELHVQILRLLLDFR 351
V+RTS+YQ+V+ F +M + + E++W+ +G +P++G+ + VQ L L +++R
Sbjct: 180 VIRTSIYQMVSAFEHDMRANAKA--SSLEKNWISEGRKPVFGSQAVLVQKLSLFIEYR 235