BP914755
Clone id YMU001_000062_E07
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000062_E07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCCGCATACATATTGCTTGGATTTTGGGATAATACCTTCGTAAAAAGTTCCCTAGCCTTT
TCCAAATGAGTTGCTTCTAGTTTCGAGTCCCTCTTTTCACCACGCCCAGCTGCATAATAA
TTCCAGTTTCCTAGAGCAAGAAGTGAATATGCATCTTTTCCATCTGTTAACTGCTGAACA
GCCTTGAACGTTTCTTTTGCCTTCAGCCAGTCATCTGCCTTCAGCTCAACATTTCCCCGA
AAAGAGAGAGCATCCACATTATTCTCTTCCAGCCTTAATGCTTCATTTATCATTTCGGTG
CAAGCAGCCATGTTGTTATTTGCTTGACCAATGGCAGCCAGTCGAAGACAAGCATCCACA
TAATTCGGACACTTGTACAGTATTAGTTTGTACAGAAAAGCAGCTTTCTCTAACTCATGA
GTCTGCTCATAAAGCCTAGCTTGATTAAACAAGATCGTTACTTTCCCAGCAGGTAGATCC
AGAGCTAGTCCCTGATCTTCTAGACGATAGAAAAA
■■Homology search results ■■ -
sp_hit_id Q6PD62
Definition sp|Q6PD62|CTR9_HUMAN RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens
Align length 154
Score (bit) 92.8
E-value 8.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914755|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_E07.
(515 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6PD62|CTR9_HUMAN RNA polymerase-associated protein CTR9 homo... 93 8e-19
sp|Q62018|CTR9_MOUSE RNA polymerase-associated protein CTR9 homo... 92 1e-18
sp|Q6DEU9|CTR9_XENTR RNA polymerase-associated protein CTR9 homo... 92 2e-18
sp|Q4QR29|CTR9_XENLA RNA polymerase-associated protein CTR9 homo... 90 7e-18
sp|Q03560|YKD1_CAEEL TPR repeat-containing protein B0464.2 OS=Ca... 70 8e-12
sp|Q57711|Y941_METJA TPR repeat-containing protein MJ0941 OS=Met... 37 0.042
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-... 37 0.054
sp|Q9ZKB5|HCPC_HELPJ Putative beta-lactamase hcpC OS=Helicobacte... 35 0.16
sp|O78490|YCF3_GUITH Photosystem I assembly protein ycf3 OS=Guil... 35 0.27
sp|P35056|PEX5_YEAST Peroxisomal targeting signal receptor OS=Sa... 35 0.27
sp|A6MVX9|YCF3_RHDSA Photosystem I assembly protein ycf3 OS=Rhod... 34 0.35
sp|Q8TAM2|TTC8_HUMAN Tetratricopeptide repeat protein 8 OS=Homo ... 33 0.60
sp|O23052|Y1515_ARATH Uncharacterized TPR repeat-containing prot... 33 1.0
sp|Q8N394|TMTC2_HUMAN Transmembrane and TPR repeat-containing pr... 33 1.0
sp|Q01495|PEX5_PICAN Peroxisomal targeting signal receptor OS=Pi... 33 1.0
sp|Q6FM42|PEX5_CANGA Peroxisomal targeting signal receptor OS=Ca... 33 1.0
sp|Q10491|YDG1_SCHPO PH and SEC7 domain-containing protein C26F1... 32 1.8
sp|Q8S8L9|Y2245_ARATH Uncharacterized TPR repeat-containing prot... 32 1.8
sp|Q9Y5Q9|TF3C3_HUMAN General transcription factor 3C polypeptid... 32 1.8
sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-... 32 1.8
sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-... 32 1.8
sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-... 32 1.8
sp|O25728|HCPC_HELPY Putative beta-lactamase hcpC OS=Helicobacte... 32 1.8
sp|Q6DCD5|TMTC2_XENLA Transmembrane and TPR repeat-containing pr... 32 2.3
sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing pr... 32 2.3
sp|Q752X0|PEX5_ASHGO Peroxisomal targeting signal receptor OS=As... 32 2.3
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE... 32 2.3
sp|O67178|Y1088_AQUAE Uncharacterized protein aq_1088 OS=Aquifex... 31 3.0
sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-... 31 3.0
sp|Q8DIQ6|YCF3_THEEB Photosystem I assembly protein ycf3 OS=Ther... 31 3.9

>sp|Q6PD62|CTR9_HUMAN RNA polymerase-associated protein CTR9 homolog
OS=Homo sapiens GN=CTR9 PE=1 SV=1
Length = 1173

Score = 92.8 bits (229), Expect = 8e-19
Identities = 55/154 (35%), Positives = 85/154 (55%), Gaps = 1/154 (0%)
Frame = -1

Query: 461 VTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMAACTEMINE 282
VT +N ARLYE E +A LYK IL + PNYVD LRL A+ + N ++ E
Sbjct: 497 VTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKE 556

Query: 281 ALRLEENNVDALSFRGNVELKADDWLKAKETFKAV-QQLTDGKDAYSLLALGNWNYYAAG 105
AL++ +++ DA S GN+ L +W ++ F+ + +Q + D YS+LALGN +
Sbjct: 557 ALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGN-VWLQTL 615

Query: 104 RGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
RD + E H ++A ++ +VL + N+YA
Sbjct: 616 HQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYA 649


>sp|Q62018|CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog
OS=Mus musculus GN=Ctr9 PE=1 SV=2
Length = 1173

Score = 92.4 bits (228), Expect = 1e-18
Identities = 55/154 (35%), Positives = 84/154 (54%), Gaps = 1/154 (0%)
Frame = -1

Query: 461 VTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMAACTEMINE 282
VT +N ARLYE E +A LYK IL + PNYVD LRL A+ + N ++ E
Sbjct: 497 VTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKE 556

Query: 281 ALRLEENNVDALSFRGNVELKADDWLKAKETFKAV-QQLTDGKDAYSLLALGNWNYYAAG 105
AL++ +++ DA S GN+ L +W ++ F+ + +Q D YS+LALGN +
Sbjct: 557 ALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPATQSDTYSMLALGN-VWLQTL 615

Query: 104 RGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
RD + E H ++A ++ +VL + N+YA
Sbjct: 616 HQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYA 649


>sp|Q6DEU9|CTR9_XENTR RNA polymerase-associated protein CTR9 homolog
OS=Xenopus tropicalis GN=ctr9 PE=2 SV=1
Length = 1172

Score = 91.7 bits (226), Expect = 2e-18
Identities = 54/154 (35%), Positives = 85/154 (55%), Gaps = 1/154 (0%)
Frame = -1

Query: 461 VTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMAACTEMINE 282
VT +N ARLYE E ++ LYK IL + PNYVD LRL A+ + N ++ E
Sbjct: 497 VTTTYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKE 556

Query: 281 ALRLEENNVDALSFRGNVELKADDWLKAKETFKAV-QQLTDGKDAYSLLALGNWNYYAAG 105
AL++ +++ DA S GN+ L +W ++ F+ + +Q + D YS+LALGN +
Sbjct: 557 ALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGN-VWLQTL 615

Query: 104 RGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
RD + E H ++A ++ +VL + N+YA
Sbjct: 616 HQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYA 649


>sp|Q4QR29|CTR9_XENLA RNA polymerase-associated protein CTR9 homolog
OS=Xenopus laevis GN=ctr9 PE=2 SV=1
Length = 1157

Score = 89.7 bits (221), Expect = 7e-18
Identities = 53/154 (34%), Positives = 85/154 (55%), Gaps = 1/154 (0%)
Frame = -1

Query: 461 VTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMAACTEMINE 282
VT +N ARLYE E ++ LYK IL + PNYVD LRL A+ + N ++ E
Sbjct: 497 VTTSYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKE 556

Query: 281 ALRLEENNVDALSFRGNVELKADDWLKAKETFKAV-QQLTDGKDAYSLLALGNWNYYAAG 105
AL++ +++ DA S GN+ L +W ++ F+ + +Q + D YS+LALGN +
Sbjct: 557 ALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGN-VWLQTL 615

Query: 104 RGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
RD + E H ++A ++ +VL + N++A
Sbjct: 616 HQPTRDREKEKRHQDRALAIYKQVLRNDSKNLFA 649


>sp|Q03560|YKD1_CAEEL TPR repeat-containing protein B0464.2
OS=Caenorhabditis elegans GN=B0464.2 PE=2 SV=3
Length = 1150

Score = 69.7 bits (169), Expect = 8e-12
Identities = 42/157 (26%), Positives = 82/157 (52%), Gaps = 4/157 (2%)
Frame = -1

Query: 461 VTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMAACTEMINE 282
+TI +N A E +A +YK I+ +CP Y+D LRL I + + + + + +
Sbjct: 526 LTIRYNLALCLEHLCRTVEAEQMYKDIVKECPGYIDGYLRLGCITRDRHQVYESSLWLKQ 585

Query: 281 ALRLEENNVDALSFRGNVELKADDWLKAKETFKAV-QQLTDGK--DAYSLLALGN-WNYY 114
++ ++ + + GN+ ++W+ A++ F+ + ++ + K D YSL+ALGN W
Sbjct: 586 GVQFDQASPIVWTLIGNLHFAKNEWMPAQKKFEFILSKIFNNKIPDPYSLVALGNVWFEQ 645

Query: 113 AAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
K++ E ++++A +++ K L P NMYA
Sbjct: 646 LLNPSRKKED--EKKYIDRALQMYQKALKLQPKNMYA 680


>sp|Q57711|Y941_METJA TPR repeat-containing protein MJ0941
OS=Methanocaldococcus jannaschii GN=MJ0941 PE=4 SV=3
Length = 338

Score = 37.4 bits (85), Expect = 0.042
Identities = 19/71 (26%), Positives = 38/71 (53%)
Frame = -1

Query: 488 LALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNM 309
+ L++ V + + + LYE+ +L++A Y+ ++ P+Y+ A L A I + N+
Sbjct: 259 IGLEIRKDDVALWYFKGELYERLGKLDEALKCYEKVIELQPHYIKALLSKARIYERQGNI 318

Query: 308 AACTEMINEAL 276
A E N+A+
Sbjct: 319 EAAIEYYNKAV 329


>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase SEC OS=Arabidopsis
thaliana GN=SEC PE=2 SV=1
Length = 977

Score = 37.0 bits (84), Expect = 0.054
Identities = 27/112 (24%), Positives = 48/112 (42%)
Frame = -1

Query: 485 ALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMA 306
AL + N A +Y + +L+ A YK L + P +++A L + +
Sbjct: 283 ALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVD 342

Query: 305 ACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKDA 150
N+ L L+ N+ A++ GN+ ++ + A FKA +T G A
Sbjct: 343 EAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSA 394



Score = 34.7 bits (78), Expect = 0.27
Identities = 20/73 (27%), Positives = 35/73 (47%)
Frame = -1

Query: 446 NQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMAACTEMINEALRLE 267
N A +++ + ++A Y + + PN+ DA LA+ ++ T+ +AL L
Sbjct: 126 NMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSNLASAYMRKGRLSEATQCCQQALSLN 185

Query: 266 ENNVDALSFRGNV 228
VDA S GN+
Sbjct: 186 PLLVDAHSNLGNL 198


>sp|Q9ZKB5|HCPC_HELPJ Putative beta-lactamase hcpC OS=Helicobacter
pylori J99 GN=hcpC PE=3 SV=1
Length = 290

Score = 35.4 bits (80), Expect = 0.16
Identities = 47/162 (29%), Positives = 62/162 (38%), Gaps = 14/162 (8%)
Frame = -1

Query: 449 FNQARLYEQTH----ELEKAAFLYKLILYKCP-NYVDACLRLAAIGQANNNMAACTEMIN 285
FN LY Q H L+KAA Y C NY + C L + + ++ T N
Sbjct: 65 FNLGVLYYQGHGVEKNLKKAASFYSKA---CDLNYSNGCHLLGNLYYSGQGVSQNT---N 118

Query: 284 EALRLEENNVDALSFRGNVELKA---------DDWLKAKETFKAVQQLTDGKDAYSLLAL 132
+AL+ D G L D+ KA E F L DG D ++L
Sbjct: 119 KALQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTKACDLNDG-DGCTILG- 176

Query: 131 GNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMY 6
+ Y AGRG +D K +KA +L N NMY
Sbjct: 177 ---SLYDAGRGTPKDLKKALASYDKACDLKDSPGCFNAGNMY 215


>sp|O78490|YCF3_GUITH Photosystem I assembly protein ycf3
OS=Guillardia theta GN=ycf3 PE=3 SV=1
Length = 172

Score = 34.7 bits (78), Expect = 0.27
Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 7/112 (6%)
Frame = -1

Query: 326 QANNNMAACTEMINEALRLEENNVDALSFRGNVEL---KADDWLKAKETFKAVQQLTDGK 156
Q+ A E EALRLEE+ D N+ L +++KA E + L
Sbjct: 46 QSEGEYAEALENYYEALRLEEDPYDRSYILYNIGLIYASNGEYVKALEYYHQALDLNSQL 105

Query: 155 DAYSLLALGN----WNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSN 12
A AL N ++Y EK++ L T +KA E + + + +P+N
Sbjct: 106 PA----ALNNIAVIYHYQGVKASEKKELDLARTLFDKAAEYWKQAIRLSPNN 153


>sp|P35056|PEX5_YEAST Peroxisomal targeting signal receptor
OS=Saccharomyces cerevisiae GN=PEX5 PE=1 SV=1
Length = 612

Score = 34.7 bits (78), Expect = 0.27
Identities = 18/63 (28%), Positives = 33/63 (52%)
Frame = -1

Query: 434 LYEQTHELEKAAFLYKLILYKCPNYVDACLRLAAIGQANNNMAACTEMINEALRLEENNV 255
L E +L +AA ++ + + P++VDA LRL + N + E L+L+ N+
Sbjct: 322 LMENGAKLSEAALAFEAAVKEKPDHVDAWLRLGLVQTQNEKELNGISALEECLKLDPKNL 381

Query: 254 DAL 246
+A+
Sbjct: 382 EAM 384


tr_hit_id A9RSJ1
Definition tr|A9RSJ1|A9RSJ1_PHYPA Paf1 complex protein OS=Physcomitrella patens subsp. patens
Align length 170
Score (bit) 214.0
E-value 2.0e-54
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914755|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_E07.
(515 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RSJ1|A9RSJ1_PHYPA Paf1 complex protein OS=Physcomitrella pa... 214 2e-54
tr|Q8VYL2|Q8VYL2_ARATH Putative TPR repeat nuclear phosphoprotei... 214 3e-54
tr|Q8S8H1|Q8S8H1_ARATH Putative TPR repeat nuclear phosphoprotei... 214 3e-54
tr|Q3EC58|Q3EC58_ARATH Uncharacterized protein At2g06210.2 OS=Ar... 214 3e-54
tr|B5X0I6|B5X0I6_ARATH VERNALIZATION INDEPENDENCE 6 OS=Arabidops... 214 3e-54
tr|A7PDY7|A7PDY7_VITVI Chromosome chr11 scaffold_13, whole genom... 194 3e-48
tr|A5B152|A5B152_VITVI Putative uncharacterized protein OS=Vitis... 194 3e-48
tr|Q8H9E4|Q8H9E4_ORYSJ Putative TPR-containing nuclear phosphopr... 180 3e-44
tr|Q0D6I4|Q0D6I4_ORYSJ Os07g0476200 protein (Fragment) OS=Oryza ... 180 3e-44
tr|B8B5Z7|B8B5Z7_ORYSI Putative uncharacterized protein OS=Oryza... 180 3e-44
tr|A3BJP3|A3BJP3_ORYSJ Putative uncharacterized protein OS=Oryza... 169 1e-40
tr|A7SPW8|A7SPW8_NEMVE Predicted protein (Fragment) OS=Nematoste... 94 4e-18
tr|A3KDM3|A3KDM3_DANRE RNA polymerase-associated protein Ctr9 ho... 93 9e-18
tr|A8K6X9|A8K6X9_HUMAN cDNA FLJ76427, highly similar to Homo sap... 93 9e-18
tr|Q05DK2|Q05DK2_MOUSE Ctr9 protein (Fragment) OS=Mus musculus G... 92 1e-17
tr|Q05CJ7|Q05CJ7_MOUSE Ctr9 protein (Fragment) OS=Mus musculus G... 92 1e-17
tr|Q08DR8|Q08DR8_BOVIN CTR9 protein (Fragment) OS=Bos taurus GN=... 92 1e-17
tr|Q8T5I7|Q8T5I7_ANOGA Putative TPR-containing phosphoprotein (A... 91 3e-17
tr|B6NTF1|B6NTF1_BRAFL Putative uncharacterized protein OS=Branc... 90 6e-17
tr|B6N9C4|B6N9C4_BRAFL Putative uncharacterized protein OS=Branc... 90 6e-17
tr|B0XB88|B0XB88_CULQU TPR repeat-containing protein OS=Culex qu... 90 6e-17
tr|Q54Y92|Q54Y92_DICDI Tetratricopeptide-like helical domain-con... 90 7e-17
tr|O96549|O96549_DICDI Developmental protein DG1071 (Fragment) O... 90 7e-17
tr|Q16PY9|Q16PY9_AEDAE Tpr repeat nuclear phosphoprotein OS=Aede... 89 2e-16
tr|Q7K0X3|Q7K0X3_DROME CG2469, isoform A OS=Drosophila melanogas... 87 5e-16
tr|B4LG73|B4LG73_DROVI GJ12147 OS=Drosophila virilis GN=GJ12147 ... 87 5e-16
tr|B4IXH5|B4IXH5_DROGR GH15212 OS=Drosophila grimshawi GN=GH1521... 87 5e-16
tr|B4HVR4|B4HVR4_DROSE GM14398 OS=Drosophila sechellia GN=GM1439... 87 5e-16
tr|Q29EV9|Q29EV9_DROPS GA15373 OS=Drosophila pseudoobscura pseud... 87 6e-16
tr|B4PD69|B4PD69_DROYA GE21142 OS=Drosophila yakuba GN=GE21142 P... 87 6e-16

>tr|A9RSJ1|A9RSJ1_PHYPA Paf1 complex protein OS=Physcomitrella
patens subsp. patens GN=PAFC1501 PE=4 SV=1
Length = 999

Score = 214 bits (546), Expect = 2e-54
Identities = 103/170 (60%), Positives = 133/170 (78%)
Frame = -1

Query: 512 FYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAA 333
F LED+G++LD+PA KVT+LFN ARL+EQ HE KA+ LY+LILYK P Y DA LRL A
Sbjct: 481 FRSLEDKGISLDIPAEKVTVLFNLARLHEQLHETGKASVLYRLILYKHPEYEDAYLRLGA 540

Query: 332 IGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKD 153
+ A +N++ E++N+AL + NV+ALS RGN+E+K DDWLKAK+TFK++ ++ DG D
Sbjct: 541 LSLARSNISTSLELVNKALEANDKNVEALSVRGNLEVKTDDWLKAKDTFKSILEIKDGND 600

Query: 152 AYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
Y++LALGNWNYYAA RGEK+ KLEATHLEKAR+L+ KVL +NMYA
Sbjct: 601 NYAMLALGNWNYYAATRGEKKVPKLEATHLEKARDLYQKVLGLQINNMYA 650


>tr|Q8VYL2|Q8VYL2_ARATH Putative TPR repeat nuclear phosphoprotein
OS=Arabidopsis thaliana GN=At2g06210 PE=2 SV=1
Length = 740

Score = 214 bits (544), Expect = 3e-54
Identities = 102/170 (60%), Positives = 134/170 (78%)
Frame = -1

Query: 512 FYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAA 333
F+RL + G ++D+P KVT LFN ARL EQ H+ E A F+Y+LIL+K P Y+DA LRLAA
Sbjct: 507 FHRLIESGHSVDVPWNKVTTLFNLARLLEQIHKTEAATFMYRLILFKYPGYIDAYLRLAA 566

Query: 332 IGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKD 153
+A NN+ E++NEAL++++ N +ALS G +ELK DDW+KAKETF+A TDGKD
Sbjct: 567 SAKAQNNLPLAIELVNEALKVDDKNPNALSLLGELELKNDDWVKAKETFRAANDATDGKD 626

Query: 152 AYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
+Y++L+LGNWNY+AA R EKR+ KLEATHLEKA+EL+TKVL+Q+ SNMYA
Sbjct: 627 SYAILSLGNWNYFAAMRNEKRNPKLEATHLEKAKELYTKVLTQHNSNMYA 676


>tr|Q8S8H1|Q8S8H1_ARATH Putative TPR repeat nuclear phosphoprotein
OS=Arabidopsis thaliana GN=At2g06210 PE=4 SV=1
Length = 1115

Score = 214 bits (544), Expect = 3e-54
Identities = 102/170 (60%), Positives = 134/170 (78%)
Frame = -1

Query: 512 FYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAA 333
F+RL + G ++D+P KVT LFN ARL EQ H+ E A F+Y+LIL+K P Y+DA LRLAA
Sbjct: 531 FHRLIESGHSVDVPWNKVTTLFNLARLLEQIHKTEAATFMYRLILFKYPGYIDAYLRLAA 590

Query: 332 IGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKD 153
+A NN+ E++NEAL++++ N +ALS G +ELK DDW+KAKETF+A TDGKD
Sbjct: 591 SAKAQNNLPLAIELVNEALKVDDKNPNALSLLGELELKNDDWVKAKETFRAANDATDGKD 650

Query: 152 AYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
+Y++L+LGNWNY+AA R EKR+ KLEATHLEKA+EL+TKVL+Q+ SNMYA
Sbjct: 651 SYAILSLGNWNYFAAMRNEKRNPKLEATHLEKAKELYTKVLTQHNSNMYA 700


>tr|Q3EC58|Q3EC58_ARATH Uncharacterized protein At2g06210.2
OS=Arabidopsis thaliana GN=At2g06210 PE=4 SV=1
Length = 852

Score = 214 bits (544), Expect = 3e-54
Identities = 102/170 (60%), Positives = 134/170 (78%)
Frame = -1

Query: 512 FYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAA 333
F+RL + G ++D+P KVT LFN ARL EQ H+ E A F+Y+LIL+K P Y+DA LRLAA
Sbjct: 268 FHRLIESGHSVDVPWNKVTTLFNLARLLEQIHKTEAATFMYRLILFKYPGYIDAYLRLAA 327

Query: 332 IGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKD 153
+A NN+ E++NEAL++++ N +ALS G +ELK DDW+KAKETF+A TDGKD
Sbjct: 328 SAKAQNNLPLAIELVNEALKVDDKNPNALSLLGELELKNDDWVKAKETFRAANDATDGKD 387

Query: 152 AYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
+Y++L+LGNWNY+AA R EKR+ KLEATHLEKA+EL+TKVL+Q+ SNMYA
Sbjct: 388 SYAILSLGNWNYFAAMRNEKRNPKLEATHLEKAKELYTKVLTQHNSNMYA 437


>tr|B5X0I6|B5X0I6_ARATH VERNALIZATION INDEPENDENCE 6 OS=Arabidopsis
thaliana GN=VIP6 PE=2 SV=1
Length = 1091

Score = 214 bits (544), Expect = 3e-54
Identities = 102/170 (60%), Positives = 134/170 (78%)
Frame = -1

Query: 512 FYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAA 333
F+RL + G ++D+P KVT LFN ARL EQ H+ E A F+Y+LIL+K P Y+DA LRLAA
Sbjct: 507 FHRLIESGHSVDVPWNKVTTLFNLARLLEQIHKTEAATFMYRLILFKYPGYIDAYLRLAA 566

Query: 332 IGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKD 153
+A NN+ E++NEAL++++ N +ALS G +ELK DDW+KAKETF+A TDGKD
Sbjct: 567 SAKAQNNLPLAIELVNEALKVDDKNPNALSLLGELELKNDDWVKAKETFRAANDATDGKD 626

Query: 152 AYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
+Y++L+LGNWNY+AA R EKR+ KLEATHLEKA+EL+TKVL+Q+ SNMYA
Sbjct: 627 SYAILSLGNWNYFAAMRNEKRNPKLEATHLEKAKELYTKVLTQHNSNMYA 676


>tr|A7PDY7|A7PDY7_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016462001
PE=4 SV=1
Length = 813

Score = 194 bits (492), Expect = 3e-48
Identities = 92/170 (54%), Positives = 130/170 (76%)
Frame = -1

Query: 512 FYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAA 333
F++LE+ G ++LP KVT+LFN ARL EQ + + A+ LY+LIL+K P+Y+DA LRLAA
Sbjct: 508 FHQLEEDGHFVELPWNKVTVLFNLARLLEQLNNTKTASILYRLILFKFPDYIDAYLRLAA 567

Query: 332 IGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKD 153
I +A NN+ E++ +AL++ + ++L G++ELK DDW+KAKETF++ TDGKD
Sbjct: 568 IAKARNNIQLSIELVGDALKVNDKGPNSLCMLGDLELKNDDWVKAKETFRSASDATDGKD 627

Query: 152 AYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
+Y+ L+LGNWNY+AA R EKR KLEATHLEKA+EL+T+VL Q+ +N+YA
Sbjct: 628 SYATLSLGNWNYFAAIRSEKRAPKLEATHLEKAKELYTRVLVQHNANLYA 677


>tr|A5B152|A5B152_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_017914 PE=4 SV=1
Length = 788

Score = 194 bits (492), Expect = 3e-48
Identities = 92/170 (54%), Positives = 130/170 (76%)
Frame = -1

Query: 512 FYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLAA 333
F++LE+ G ++LP KVT+LFN ARL EQ + + A+ LY+LIL+K P+Y+DA LRLAA
Sbjct: 508 FHQLEEDGHFVELPWNKVTVLFNLARLLEQLNNTKTASILYRLILFKFPDYIDAYLRLAA 567

Query: 332 IGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADDWLKAKETFKAVQQLTDGKD 153
I +A NN+ E++ +AL++ + ++L G++ELK DDW+KAKETF++ TDGKD
Sbjct: 568 IAKARNNIQLSIELVGDALKVNDKGPNSLCMLGDLELKNDDWVKAKETFRSASDATDGKD 627

Query: 152 AYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
+Y+ L+LGNWNY+AA R EKR KLEATHLEKA+EL+T+VL Q+ +N+YA
Sbjct: 628 SYATLSLGNWNYFAAIRSEKRAPKLEATHLEKAKELYTRVLVQHNANLYA 677


>tr|Q8H9E4|Q8H9E4_ORYSJ Putative TPR-containing nuclear phosphoprotein
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 1069

Score = 180 bits (457), Expect = 3e-44
Identities = 86/172 (50%), Positives = 124/172 (72%), Gaps = 1/172 (0%)
Frame = -1

Query: 515 FFYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLA 336
FF +LE++G L+LP KVT LFN ARL+E+ H+ KA+ Y+LI++K P+Y+D LRLA
Sbjct: 514 FFQQLEEEGTPLELPWDKVTTLFNYARLFEELHDTVKASLFYRLIIFKYPDYIDTYLRLA 573

Query: 335 AIGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADD-WLKAKETFKAVQQLTDG 159
AI + NN+ E+I +AL++++ +ALS G++EL+ D+ WL AKE F+ + ++G
Sbjct: 574 AIAKEKNNLQLSIELIGDALKIDDKYPNALSMLGSLELQGDETWLTAKEHFREAKDASEG 633

Query: 158 KDAYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
KD YS+L LGNWNY+AA R EK+ K EATH EKA+EL++ VL Q+ NM+A
Sbjct: 634 KDTYSMLQLGNWNYFAANRPEKKAPKFEATHREKAKELYSNVLKQHHGNMFA 685


>tr|Q0D6I4|Q0D6I4_ORYSJ Os07g0476200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os07g0476200 PE=4 SV=1
Length = 629

Score = 180 bits (457), Expect = 3e-44
Identities = 86/172 (50%), Positives = 124/172 (72%), Gaps = 1/172 (0%)
Frame = -1

Query: 515 FFYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLA 336
FF +LE++G L+LP KVT LFN ARL+E+ H+ KA+ Y+LI++K P+Y+D LRLA
Sbjct: 74 FFQQLEEEGTPLELPWDKVTTLFNYARLFEELHDTVKASLFYRLIIFKYPDYIDTYLRLA 133

Query: 335 AIGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADD-WLKAKETFKAVQQLTDG 159
AI + NN+ E+I +AL++++ +ALS G++EL+ D+ WL AKE F+ + ++G
Sbjct: 134 AIAKEKNNLQLSIELIGDALKIDDKYPNALSMLGSLELQGDETWLTAKEHFREAKDASEG 193

Query: 158 KDAYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
KD YS+L LGNWNY+AA R EK+ K EATH EKA+EL++ VL Q+ NM+A
Sbjct: 194 KDTYSMLQLGNWNYFAANRPEKKAPKFEATHREKAKELYSNVLKQHHGNMFA 245


>tr|B8B5Z7|B8B5Z7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25970 PE=4 SV=1
Length = 1174

Score = 180 bits (457), Expect = 3e-44
Identities = 86/172 (50%), Positives = 124/172 (72%), Gaps = 1/172 (0%)
Frame = -1

Query: 515 FFYRLEDQGLALDLPAGKVTILFNQARLYEQTHELEKAAFLYKLILYKCPNYVDACLRLA 336
FF +LE++G L+LP KVT LFN ARL+E+ H+ KA+ Y+LI++K P+Y+D LRLA
Sbjct: 619 FFQQLEEEGTPLELPWDKVTTLFNYARLFEELHDTVKASLFYRLIIFKYPDYIDTYLRLA 678

Query: 335 AIGQANNNMAACTEMINEALRLEENNVDALSFRGNVELKADD-WLKAKETFKAVQQLTDG 159
AI + NN+ E+I +AL++++ +ALS G++EL+ D+ WL AKE F+ + ++G
Sbjct: 679 AIAKEKNNLQLSIELIGDALKIDDKYPNALSMLGSLELQGDETWLTAKEHFREAKDASEG 738

Query: 158 KDAYSLLALGNWNYYAAGRGEKRDSKLEATHLEKARELFTKVLSQNPSNMYA 3
KD YS+L LGNWNY+AA R EK+ K EATH EKA+EL++ VL Q+ NM+A
Sbjct: 739 KDTYSMLQLGNWNYFAANRPEKKAPKFEATHREKAKELYSNVLKQHRGNMFA 790