BP914784
Clone id YMU001_000062_H01
Library
Length 525
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000062_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGTGTCGGGCCATAAGCCATAGCCAACTTCAAGAAAAATCCCAAAAAAGAATGGCTGAAA
ATAAAAGGACGGAGACATGACATTATGGGGGACATAAGCTCAGATGACATGTACATGTAT
GTGGAACAACTATATGTGCATAATAATGTGGAAGAAATGCCACGCATGCAAACCGATCTC
CATGCCCAAGACCACTTTGATCCCGGAACGGTTAAAAAAGGCATACAGAAACTTGCAAAT
GGGAAAGCTCCGGACATACTACACTTGAACTCAGAAATGCTTAAATGGTCAGGTATGAGA
GCCAGAGAGTGGATACATAGAATGCTAAACCAAGCCATTGTTCAAGGGCTACCCGAGGAT
TGGCAAAAGAACTGGATCAAAACACTTTACAAAAAAGGGGATGTAAATCAGCCTACCAAC
TACCGTACCATTATGGTTGGATCTTGCATGGCAAAGCTTTTGGGAAGCATCTTAGAATAA
AGCATAAGCACATGGGCAGAGACAAATGGAAAACGAGCAACAGGT
■■Homology search results ■■ -
sp_hit_id Q9RRC4
Definition sp|Q9RRC4|SYR_DEIRA Arginyl-tRNA synthetase OS=Deinococcus radiodurans
Align length 174
Score (bit) 38.1
E-value 0.026
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914784|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_H01.
(525 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9RRC4|SYR_DEIRA Arginyl-tRNA synthetase OS=Deinococcus radio... 38 0.026
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 34 0.49
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 32 1.4
sp|Q9LSL8|PP446_ARATH Pentatricopeptide repeat-containing protei... 31 3.2
sp|Q03274|PO22_POPJA Retrovirus-related Pol polyprotein from typ... 31 3.2
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamylo... 31 3.2
sp|Q6BZA0|ALO_DEBHA D-arabinono-1,4-lactone oxidase OS=Debaryomy... 31 4.1
sp|Q9NIW4|TRA2_CAERE Sex-determining transformer protein 2 OS=Ca... 31 4.1
sp|Q8Y750|ERA_LISMO GTP-binding protein era homolog OS=Listeria ... 31 4.1
sp|Q71ZK8|ERA_LISMF GTP-binding protein era homolog OS=Listeria ... 31 4.1
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bac... 31 4.1
sp|P03161|DPOL_GSHV Protein P OS=Ground squirrel hepatitis virus... 30 5.4
sp|P45028|Y1084_HAEIN Uncharacterized protein HI1084 OS=Haemophi... 30 7.1
sp|Q7V7J0|Y755_PROMM UPF0182 protein PMT0755 OS=Prochlorococcus ... 30 9.2
sp|A2C9P7|Y1461_PROM3 UPF0182 protein P9303_14611 OS=Prochloroco... 30 9.2
sp|Q0A6U0|METE_ALHEH 5-methyltetrahydropteroyltriglutamate--homo... 30 9.2
sp|Q3AEZ3|ERA_CARHZ GTP-binding protein era homolog OS=Carboxydo... 30 9.2
sp|Q9BRK5|CAB45_HUMAN 45 kDa calcium-binding protein OS=Homo sap... 30 9.2

>sp|Q9RRC4|SYR_DEIRA Arginyl-tRNA synthetase OS=Deinococcus
radiodurans GN=argS PE=3 SV=1
Length = 609

Score = 38.1 bits (87), Expect = 0.026
Identities = 45/174 (25%), Positives = 72/174 (41%), Gaps = 1/174 (0%)
Frame = +1

Query: 1 RVGP*AIANFKKNPKKEWLKIKGRRHDIMGDISSDDMYMYVEQLYVHNNVEEMPRMQTD- 177
R G I + NP KE L + R+ ++GD + + + V N +++ R +
Sbjct: 103 REGKVVIEHTSVNPNKE-LHVGHLRNVVLGDSMARILRAAGHTVEVQNYIDDTGRQAAES 161

Query: 178 LHAQDHFDPGTVKKGIQKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQAIVQGLPE 357
L A H+ G V G+QK + LN++ K I L ++ L E
Sbjct: 162 LFATQHY--GRVWDGVQKYDQWLGEGYVQLNADPQKPELESGIMEIMHKLEAGELRPLVE 219

Query: 358 DWQKNWIKTLYKKGDVNQPTNYRTIMVGSCMAKLLGSILE*SISTWAETNGKRA 519
K ++T ++ G N+ + +VGS +ILE S T T GK A
Sbjct: 220 QTVKAQLQTCFRLGARYDLLNWESDVVGSGFLAQAMNILEGSRYTSRPTEGKYA 273


>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing
protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22
PE=3 SV=1
Length = 743

Score = 33.9 bits (76), Expect = 0.49
Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 18/67 (26%)
Frame = +1

Query: 25 NFKKNPKKEWLKIKGRRHDIMGDISS----DDMYMYVEQL--------------YVHNNV 150
N KK P + W+K KG+ H D S D +Y +E+L +VH++V
Sbjct: 604 NVKKEPGQSWIKWKGKLHSFSADDESSPYLDQIYAKLEELNNKIIDNGYKPDTSFVHHDV 663

Query: 151 EEMPRMQ 171
EE +++
Sbjct: 664 EEAVKVK 670


>sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1
Length = 528

Score = 32.3 bits (72), Expect = 1.4
Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 3/73 (4%)
Frame = +1

Query: 181 HAQDHFDPGTVKKGIQKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQA---IVQGL 351
H D T+K GI K A D+ H NS + + R W+ ++ V+ +
Sbjct: 205 HHNGGTDFSTLKNGIYKNLYDLA-DLNHNNSTIDTYFKNAIRLWLDMGIDGIRVDAVKHM 263

Query: 352 PEDWQKNWIKTLY 390
P WQKNW+ ++Y
Sbjct: 264 PFGWQKNWMSSIY 276


>sp|Q9LSL8|PP446_ARATH Pentatricopeptide repeat-containing protein
At5g65570 OS=Arabidopsis thaliana GN=PCMP-H47 PE=2 SV=1
Length = 738

Score = 31.2 bits (69), Expect = 3.2
Identities = 22/84 (26%), Positives = 40/84 (47%)
Frame = +1

Query: 31 KKNPKKEWLKIKGRRHDIMGDISSDDMYMYVEQLYVHNNVEEMPRMQTDLHAQDHFDPGT 210
KKNP W++I H M + D++ + + N+EE+ + DL + D
Sbjct: 601 KKNPAMSWVEINKETHTFM----AGDLFSHPNSEQILENLEELIKKSKDLGYVE--DKSC 654

Query: 211 VKKGIQKLANGKAPDILHLNSEML 282
V + +++ A ++ LH +SE L
Sbjct: 655 VFQDMEETAKERS---LHQHSEKL 675


>sp|Q03274|PO22_POPJA Retrovirus-related Pol polyprotein from type-1
retrotransposable element R2 (Fragment) OS=Popillia
japonica PE=4 SV=1
Length = 711

Score = 31.2 bits (69), Expect = 3.2
Identities = 14/42 (33%), Positives = 22/42 (52%)
Frame = +1

Query: 349 LPEDWQKNWIKTLYKKGDVNQPTNYRTIMVGSCMAKLLGSIL 474
+P W + K GD+ P+N+R I + S + +LL IL
Sbjct: 52 VPTPWTAMRTTLIPKDGDLENPSNWRPITIASALQRLLHRIL 93


>sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus
thermoamyloliquefaciens PE=3 SV=1
Length = 787

Score = 31.2 bits (69), Expect = 3.2
Identities = 29/133 (21%), Positives = 50/133 (37%), Gaps = 18/133 (13%)
Frame = +1

Query: 7 GP*AIANFKKNPKKEWLKIKGRRHDIMGDISSDDMYMYVEQLYVHNNVEEM--------- 159
G A +F ++W G +H D+ + ++ + + V N + M
Sbjct: 373 GKSAFPDFTNKKVRKWW---GEKHQFYTDLGIEGIWNDMNEPSVFNETKTMDVKVIHDND 429

Query: 160 --PRMQTDLHAQDHFDPGTVK-KGIQKLANGKAPDIL------HLNSEMLKWSGMRAREW 312
P+ +LH F G KG++KL NGK P +L + W+G W
Sbjct: 430 GDPKTHRELHNVYGFMMGEATYKGMKKLLNGKRPFLLTRAGFSGIQRYAAVWTGDNRSFW 489

Query: 313 IHRMLNQAIVQGL 351
H ++ + L
Sbjct: 490 EHLQMSLPMCMNL 502


>sp|Q6BZA0|ALO_DEBHA D-arabinono-1,4-lactone oxidase OS=Debaryomyces
hansenii GN=ALO1 PE=3 SV=2
Length = 557

Score = 30.8 bits (68), Expect = 4.1
Identities = 18/54 (33%), Positives = 22/54 (40%)
Frame = -3

Query: 337 WLGLAFYVSTLWLSYLTI*AFLSSSVVCPELSHLQVSVCLF*PFRDQSGLGHGD 176
W G FY S LW+S +CP L+ L + D LGHGD
Sbjct: 272 WFGRKFYESLLWISV----------HICPHLTPLIEKFVFKNQYGDVETLGHGD 315


>sp|Q9NIW4|TRA2_CAERE Sex-determining transformer protein 2
OS=Caenorhabditis remanei GN=tra-2 PE=1 SV=1
Length = 1485

Score = 30.8 bits (68), Expect = 4.1
Identities = 12/46 (26%), Positives = 25/46 (54%)
Frame = +1

Query: 253 DILHLNSEMLKWSGMRAREWIHRMLNQAIVQGLPEDWQKNWIKTLY 390
D ++SEM KW+ +++R L + + + E ++ +IK+ Y
Sbjct: 156 DSYRIHSEMSKWNTSNVTNFLNRKLRNSYIDAIGESEERPYIKSTY 201


>sp|Q8Y750|ERA_LISMO GTP-binding protein era homolog OS=Listeria
monocytogenes GN=era PE=3 SV=1
Length = 301

Score = 30.8 bits (68), Expect = 4.1
Identities = 16/40 (40%), Positives = 22/40 (55%)
Frame = +1

Query: 256 ILHLNSEMLKWSGMRAREWIHRMLNQAIVQGLPEDWQKNW 375
I+ +MLK GMRAR+ I R+L + + QKNW
Sbjct: 245 IIGKQGQMLKQIGMRARKEIERLLGSKVFLEIWVKVQKNW 284


>sp|Q71ZK8|ERA_LISMF GTP-binding protein era homolog OS=Listeria
monocytogenes serotype 4b (strain F2365) GN=era PE=3
SV=1
Length = 301

Score = 30.8 bits (68), Expect = 4.1
Identities = 16/40 (40%), Positives = 22/40 (55%)
Frame = +1

Query: 256 ILHLNSEMLKWSGMRAREWIHRMLNQAIVQGLPEDWQKNW 375
I+ +MLK GMRAR+ I R+L + + QKNW
Sbjct: 245 IIGKQGQMLKQIGMRARKEIERLLGSKVFLEIWVKVQKNW 284


tr_hit_id A7RKZ5
Definition tr|A7RKZ5|A7RKZ5_NEMVE Predicted protein (Fragment) OS=Nematostella vectensis
Align length 95
Score (bit) 60.5
E-value 5.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914784|Adiantum capillus-veneris mRNA, clone:
YMU001_000062_H01.
(525 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7RKZ5|A7RKZ5_NEMVE Predicted protein (Fragment) OS=Nematoste... 60 5e-08
tr|B8NZ53|B8NZ53_ASPFL LINE-1 retrotransposon-like element, puta... 55 3e-06
tr|A7STJ5|A7STJ5_NEMVE Predicted protein (Fragment) OS=Nematoste... 51 3e-05
tr|Q0Q535|Q0Q535_9STRA Reverse transcriptase (Fragment) OS=Phyto... 45 0.002
tr|B7Q3R2|B7Q3R2_IXOSC Putative uncharacterized protein (Fragmen... 45 0.002
tr|A7SJY4|A7SJY4_NEMVE Predicted protein (Fragment) OS=Nematoste... 45 0.002
tr|Q5C3A7|Q5C3A7_SCHJA SJCHGC06937 protein (Fragment) OS=Schisto... 45 0.002
tr|A7T462|A7T462_NEMVE Predicted protein (Fragment) OS=Nematoste... 45 0.002
tr|A2Q4S9|A2Q4S9_MEDTR RNA-directed DNA polymerase (Reverse tran... 44 0.004
tr|Q5EFF8|Q5EFF8_9SCOR Reverse transcriptase (Fragment) OS=Hadru... 44 0.005
tr|A7SYL1|A7SYL1_NEMVE Predicted protein (Fragment) OS=Nematoste... 44 0.005
tr|Q5EFH2|Q5EFH2_9SCOR Reverse transcriptase (Fragment) OS=Smeri... 43 0.011
tr|Q789D2|Q789D2_CHICK Reverse transcriptase (Fragment) OS=Gallu... 42 0.015
tr|Q08525|Q08525_CHICK Putative uncharacterized protein OS=Gallu... 42 0.015
tr|Q08515|Q08515_CHICK POL-like (Fragment) OS=Gallus gallus PE=4... 42 0.015
tr|Q5C3A3|Q5C3A3_SCHJA SJCHGC09318 protein (Fragment) OS=Schisto... 42 0.015
tr|Q18LA3|Q18LA3_DROSE Pol protein (Fragment) OS=Drosophila sech... 42 0.015
tr|Q4QQE9|Q4QQE9_SCHMA Endonuclease-reverse transcriptase OS=Sch... 42 0.019
tr|Q17003|Q17003_ANOGA Putative reverse transcriptase OS=Anophel... 41 0.042
tr|Q4QQE8|Q4QQE8_SCHMA Endonuclease-reverse transcriptase OS=Sch... 40 0.055
tr|Q0MXP3|Q0MXP3_9NEOP Reverse transcriptase (Fragment) OS=Macul... 40 0.055
tr|Q0MWX5|Q0MWX5_9NEOP Reverse transcriptase (Fragment) OS=Macul... 40 0.072
tr|Q5EFF9|Q5EFF9_9SCOR Reverse transcriptase (Fragment) OS=Hadru... 40 0.094
tr|Q1HW07|Q1HW07_PENMO Reverse transcriptase (Fragment) OS=Penae... 40 0.094
tr|Q0MXP6|Q0MXP6_9NEOP Reverse transcriptase (Fragment) OS=Macul... 40 0.094
tr|Q0MXP2|Q0MXP2_9NEOP Reverse transcriptase (Fragment) OS=Macul... 40 0.094
tr|B7P3Y9|B7P3Y9_IXOSC Reverse transcriptase, putative OS=Ixodes... 40 0.094
tr|A0FGX8|A0FGX8_9NEOP Reverse transcriptase (Fragment) OS=Macul... 40 0.094
tr|A0FGX7|A0FGX7_9NEOP Reverse transcriptase (Fragment) OS=Macul... 40 0.094
tr|B7XBB2|B7XBB2_RHIOR Polyprotein (Fragment) OS=Rhizopus oryzae... 40 0.094

>tr|A7RKZ5|A7RKZ5_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g63230 PE=4 SV=1
Length = 115

Score = 60.5 bits (145), Expect = 5e-08
Identities = 34/95 (35%), Positives = 51/95 (53%), Gaps = 1/95 (1%)
Frame = +1

Query: 226 QKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQAIVQGL-PEDWQKNWIKTLYKKGD 402
+KL N KAP I + +EMLK I ++ N + G+ P+ W + I +YK GD
Sbjct: 1 KKLKNNKAPGIDRIRNEMLKCGQQTLVPCISKIFNLILDAGVYPDVWTRGIISAIYKSGD 60

Query: 403 VNQPTNYRTIMVGSCMAKLLGSILE*SISTWAETN 507
+ P++YR I V SC+ KL IL + T+ +N
Sbjct: 61 KSDPSDYRGICVTSCLGKLFCFILNNRLQTFLTSN 95


>tr|B8NZ53|B8NZ53_ASPFL LINE-1 retrotransposon-like element,
putative (Fragment) OS=Aspergillus flavus NRRL3357
GN=AFLA_063980 PE=4 SV=1
Length = 435

Score = 54.7 bits (130), Expect = 3e-06
Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 1/91 (1%)
Frame = +1

Query: 205 GTVKKGIQKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQAI-VQGLPEDWQKNWIK 381
G VK IQ+L N KA + +E++K R +HR++ + + LPE+W++ I
Sbjct: 141 GEVKDAIQQLKNNKAAGKDGIGAELIKMGPDRLAACLHRLIVRIWETEQLPEEWKQGVIC 200

Query: 382 TLYKKGDVNQPTNYRTIMVGSCMAKLLGSIL 474
+YKKGD + NYR I + + K+L IL
Sbjct: 201 PIYKKGDKLECENYRAITILNAAYKVLSQIL 231


>tr|A7STJ5|A7STJ5_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g131160 PE=4 SV=1
Length = 99

Score = 51.2 bits (121), Expect = 3e-05
Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
Frame = +1

Query: 232 LANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQAIVQGL-PEDWQKNWIKTLYKKGDVN 408
L N KA LN+E++K S + ++ N + QG+ P+ W K +I L+K GD
Sbjct: 15 LKNKKASAGDSLNNEIIKVSVESQGRYFVKLFNTVLTQGVFPKSWSKGYIVPLHKSGDKC 74

Query: 409 QPTNYRTIMVGSCMAK 456
P NYR I + SC+ K
Sbjct: 75 DPGNYRGIAISSCIGK 90


>tr|Q0Q535|Q0Q535_9STRA Reverse transcriptase (Fragment)
OS=Phytophthora ramorum PE=4 SV=1
Length = 704

Score = 45.4 bits (106), Expect = 0.002
Identities = 17/57 (29%), Positives = 33/57 (57%)
Frame = +1

Query: 349 LPEDWQKNWIKTLYKKGDVNQPTNYRTIMVGSCMAKLLGSILE*SISTWAETNGKRA 519
+P+ W+ ++ L+KKG+ +P N+R I + + KL +L ++ W + NG+ A
Sbjct: 482 VPQSWKVGVVRLLFKKGERTEPANWRPICLQQAIYKLYAGVLARRLTRWLDANGRHA 538


>tr|B7Q3R2|B7Q3R2_IXOSC Putative uncharacterized protein (Fragment)
OS=Ixodes scapularis GN=IscW_ISCW009987 PE=4 SV=1
Length = 205

Score = 45.4 bits (106), Expect = 0.002
Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 1/105 (0%)
Frame = +1

Query: 196 FDPGTVKKGIQKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQAIVQG-LPEDWQKN 372
FD + K I L + I ++N++ L+ + + + ++ Q+I+ G LPEDW+
Sbjct: 56 FDFDGIVKLIDNLKVSSSCGIDNINTKFLRNTKIYGAIFFTKIFEQSILTGVLPEDWKTG 115

Query: 373 WIKTLYKKGDVNQPTNYRTIMVGSCMAKLLGSILE*SISTWAETN 507
+ L+K GD + NYR I + S K+L I+ + + E+N
Sbjct: 116 KVVPLHKSGDKHCFDNYRPISITSTPCKMLEHIIYSHLVKYLESN 160


>tr|A7SJY4|A7SJY4_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g57281 PE=4 SV=1
Length = 99

Score = 45.4 bits (106), Expect = 0.002
Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
Frame = +1

Query: 265 LNSEMLKWSGMRAREWIHRMLNQAIVQGL-PEDWQKNWIKTLYKKGDVNQPTNYRTIMVG 441
LN+E++K S + ++ N + QG+ + W K +I L+K GD NYR I +
Sbjct: 8 LNNEIIKVSVESQGRYFEKLFNTVLAQGVFSKSWSKGYIVQLHKSGDKCDRGNYRGIAIS 67

Query: 442 SCMAKLLGSIL 474
SC+ K I+
Sbjct: 68 SCLGKFFTLII 78


>tr|Q5C3A7|Q5C3A7_SCHJA SJCHGC06937 protein (Fragment)
OS=Schistosoma japonicum PE=2 SV=2
Length = 244

Score = 45.1 bits (105), Expect = 0.002
Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 1/106 (0%)
Frame = +1

Query: 160 PRMQTDLHAQDHFDPGTVKKGIQKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQAI 339
P Q DL ++ V+K I L G+A L E+ K G + +L++
Sbjct: 73 PECQIDLTPPSLYE---VEKAIGNLKRGRAAGPDRLTPEVFKDGGPVLAARLTEILSRIW 129

Query: 340 VQG-LPEDWQKNWIKTLYKKGDVNQPTNYRTIMVGSCMAKLLGSIL 474
G +P DW ++ I +YKKG + N+R I + + ++KLL SI+
Sbjct: 130 ELGVIPSDWSQSLIVPIYKKGQKSSCDNHRGISLTNIVSKLLASII 175


>tr|A7T462|A7T462_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g47487 PE=4 SV=1
Length = 90

Score = 45.1 bits (105), Expect = 0.002
Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
Frame = +1

Query: 205 GTVKKGIQKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQA-IVQGLPEDWQKNWIK 381
G VK I L NGK+P I ++ +E+LK E +H++L + + +P DW+K I
Sbjct: 9 GEVKDTITTLKNGKSPGIDNITAELLKADPEFLDERVHKLLVKVWRHKTIPNDWKKGLII 68

Query: 382 TLYKKGDVNQPTNYRTI 432
L KKG++ + N R I
Sbjct: 69 KLPKKGNLKECKNSRGI 85


>tr|A2Q4S9|A2Q4S9_MEDTR RNA-directed DNA polymerase (Reverse
transcriptase) OS=Medicago truncatula
GN=MtrDRAFT_AC157890g32v2 PE=4 SV=1
Length = 243

Score = 44.3 bits (103), Expect = 0.004
Identities = 25/85 (29%), Positives = 50/85 (58%), Gaps = 2/85 (2%)
Frame = +1

Query: 211 VKKGIQKLANGKAPDILHLNSEMLKWSGMRAREWIHRMLNQAI-VQGLPEDWQKNWIKTL 387
VK+ +++++NGKA ++ E+ K G R W+ ++ N+ + + + ++W+++ + +
Sbjct: 22 VKEALKRMSNGKAVGPDNIPIEVWKSLGDRGIVWLTKLFNEIMKTKKMLDEWRRSTLIPI 81

Query: 388 YK-KGDVNQPTNYRTIMVGSCMAKL 459
YK KGD+ NYR I + S KL
Sbjct: 82 YKNKGDIQHCANYRGIKLMSHTMKL 106


>tr|Q5EFF8|Q5EFF8_9SCOR Reverse transcriptase (Fragment)
OS=Hadruroides charcasus GN=RT PE=4 SV=1
Length = 192

Score = 43.9 bits (102), Expect = 0.005
Identities = 19/53 (35%), Positives = 32/53 (60%)
Frame = +1

Query: 349 LPEDWQKNWIKTLYKKGDVNQPTNYRTIMVGSCMAKLLGSILE*SISTWAETN 507
LPEDW+K+++ KKG+ N NYR I + C+ K++ I+ I+ + +N
Sbjct: 40 LPEDWKKSFVIPFCKKGNKNSLDNYRPISITCCVTKIMEHIIASQITNYLFSN 92