BP914800
Clone id YMU001_000063_A06
Library
Length 544
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AATTCGCGGCCGCGAATTGAGCCGCATAGATATACATAACTTGTTAAGAAAAAAAATAGT
TCGTTAAAGCTTAAGGCACAAAAATTGTTACCGGGTAACATCACGATTACATCATTGGAA
TCTATTTACGTTTGCGTCACAGCAAAACTGGACACTCTGTATGGCATTATTTTGAAAAGC
CTGAGTAAGGGCCAAATGCCCTTGTTACACCAAAGCAGACGGCTCTGACGGACGTCTCAA
AACAATCCGTGTGACAAACACTAGTGCTTACAACAAACCACACACTCCAAATGCCTCGTG
GTTTTTGATGACAGACTCAGCATAGGTATCATGTTTTGAGCACCTAACCAAAATATCCAT
GCTGGCCTCCCCCACCATCCTATAAGCCACTTTACTACTGGGCTTTCATACAATCTAGAA
CTCTTCACACCACTTGTCGAGAGTGAGAACACCAATACGCAATATGCTCATCTTTGCGAT
GGCCGCTGACAAGCCCACCACATTGCAAACAGATGAAGCTACTGCCATCTGCAGATGCAT
CCAG
■■Homology search results ■■ -
sp_hit_id Q3SHE5
Definition sp|Q3SHE5|PSD_THIDA Phosphatidylserine decarboxylase proenzyme OS=Thiobacillus denitrificans (strain ATCC 25259)
Align length 16
Score (bit) 30.4
E-value 5.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914800|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_A06.
(526 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3SHE5|PSD_THIDA Phosphatidylserine decarboxylase proenzyme O... 30 5.3
sp|Q89B31|EFP_BUCBP Elongation factor P OS=Buchnera aphidicola s... 30 5.4

>sp|Q3SHE5|PSD_THIDA Phosphatidylserine decarboxylase proenzyme
OS=Thiobacillus denitrificans (strain ATCC 25259) GN=psd
PE=3 SV=1
Length = 208

Score = 30.4 bits (67), Expect = 5.3
Identities = 9/16 (56%), Positives = 11/16 (68%)
Frame = -3

Query: 380 VVKWLIGWWGRPAWIF 333
+ WLIGWW P WI+
Sbjct: 23 IATWLIGWWSVPFWIW 38


>sp|Q89B31|EFP_BUCBP Elongation factor P OS=Buchnera aphidicola
subsp. Baizongia pistaciae GN=efp PE=3 SV=1
Length = 189

Score = 30.4 bits (67), Expect = 5.4
Identities = 10/44 (22%), Positives = 26/44 (59%)
Frame = +2

Query: 5 RIDIHNLLRKKIVR*SLRHKNCYRVTSRLHHWNLFTFASQQNWT 136
R+ + NLL KK++ + ++ +C+++ + + + F ++ WT
Sbjct: 40 RVRLKNLLNKKLIDKTCKYSDCFKIANVIEITATYMFTDKKVWT 83


tr_hit_id Q9FIJ8
Definition tr|Q9FIJ8|Q9FIJ8_ARATH Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MCA23 OS=Arabidopsis thaliana
Align length 34
Score (bit) 67.0
E-value 6.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914800|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_A06.
(526 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9FIJ8|Q9FIJ8_ARATH Arabidopsis thaliana genomic DNA, chromos... 67 6e-10
tr|Q3E8E9|Q3E8E9_ARATH Uncharacterized protein At5g47830.2 OS=Ar... 67 6e-10
tr|Q1ECG7|Q1ECG7_ARATH At5g47830 OS=Arabidopsis thaliana PE=2 SV=1 67 6e-10
tr|A9NN14|A9NN14_PICSI Putative uncharacterized protein OS=Picea... 67 6e-10
tr|A7NU06|A7NU06_VITVI Chromosome chr18 scaffold_1, whole genome... 67 7e-10
tr|A9NSL4|A9NSL4_PICSI Putative uncharacterized protein OS=Picea... 65 2e-09
tr|A9NYK9|A9NYK9_PICSI Putative uncharacterized protein OS=Picea... 62 1e-08
tr|Q6ET41|Q6ET41_ORYSJ Os02g0158600 protein OS=Oryza sativa subs... 61 3e-08
tr|B6U5J3|B6U5J3_MAIZE Putative uncharacterized protein OS=Zea m... 61 3e-08
tr|A9SW11|A9SW11_PHYPA Predicted protein (Fragment) OS=Physcomit... 61 3e-08
tr|A2X145|A2X145_ORYSI Putative uncharacterized protein OS=Oryza... 61 3e-08
tr|A9S6B0|A9S6B0_PHYPA Predicted protein OS=Physcomitrella paten... 60 9e-08
tr|Q2HTP5|Q2HTP5_MEDTR Putative uncharacterized protein OS=Medic... 59 2e-07
tr|B8BQ34|B8BQ34_THAPS Predicted protein OS=Thalassiosira pseudo... 39 0.16
tr|A9WUQ5|A9WUQ5_RENSM Permease OS=Renibacterium salmoninarum (s... 33 8.6
tr|B7AZ86|B7AZ86_9FIRM Putative uncharacterized protein OS=Mitsu... 33 8.8

>tr|Q9FIJ8|Q9FIJ8_ARATH Arabidopsis thaliana genomic DNA, chromosome
5, P1 clone:MCA23 OS=Arabidopsis thaliana PE=4 SV=1
Length = 202

Score = 67.0 bits (162), Expect = 6e-10
Identities = 29/34 (85%), Positives = 31/34 (91%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWCSH 425
LDA ADGSSFICLQCGGLVS HR+DEH AYWCS+
Sbjct: 168 LDAFADGSSFICLQCGGLVSIHRRDEHYAYWCSN 201


>tr|Q3E8E9|Q3E8E9_ARATH Uncharacterized protein At5g47830.2
OS=Arabidopsis thaliana GN=At5g47830 PE=4 SV=1
Length = 123

Score = 67.0 bits (162), Expect = 6e-10
Identities = 29/34 (85%), Positives = 31/34 (91%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWCSH 425
LDA ADGSSFICLQCGGLVS HR+DEH AYWCS+
Sbjct: 89 LDAFADGSSFICLQCGGLVSIHRRDEHYAYWCSN 122


>tr|Q1ECG7|Q1ECG7_ARATH At5g47830 OS=Arabidopsis thaliana PE=2 SV=1
Length = 173

Score = 67.0 bits (162), Expect = 6e-10
Identities = 29/34 (85%), Positives = 31/34 (91%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWCSH 425
LDA ADGSSFICLQCGGLVS HR+DEH AYWCS+
Sbjct: 139 LDAFADGSSFICLQCGGLVSIHRRDEHYAYWCSN 172


>tr|A9NN14|A9NN14_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 173

Score = 67.0 bits (162), Expect = 6e-10
Identities = 29/36 (80%), Positives = 32/36 (88%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWCSHSR 419
+DA ADGSSFICL+CGGLVS RKDEHIAYWCS +R
Sbjct: 137 MDAFADGSSFICLRCGGLVSNTRKDEHIAYWCSDAR 172


>tr|A7NU06|A7NU06_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014869001
PE=4 SV=1
Length = 167

Score = 66.6 bits (161), Expect = 7e-10
Identities = 28/32 (87%), Positives = 29/32 (90%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWC 431
LDA +DGSSFICLQCGGLVS HRKDEH AYWC
Sbjct: 133 LDAFSDGSSFICLQCGGLVSNHRKDEHYAYWC 164


>tr|A9NSL4|A9NSL4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 173

Score = 65.1 bits (157), Expect = 2e-09
Identities = 28/33 (84%), Positives = 30/33 (90%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWCS 428
+DA ADGSSFICL+CGGLVS RKDEHIAYWCS
Sbjct: 137 MDAFADGSSFICLRCGGLVSNTRKDEHIAYWCS 169


>tr|A9NYK9|A9NYK9_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 169

Score = 62.4 bits (150), Expect = 1e-08
Identities = 25/32 (78%), Positives = 29/32 (90%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWC 431
+DA ADGSSF+CLQCGGLVS R+DEH+AYWC
Sbjct: 134 MDAFADGSSFVCLQCGGLVSNLRRDEHLAYWC 165


>tr|Q6ET41|Q6ET41_ORYSJ Os02g0158600 protein OS=Oryza sativa subsp.
japonica GN=P0419H03.39 PE=2 SV=1
Length = 178

Score = 61.2 bits (147), Expect = 3e-08
Identities = 26/32 (81%), Positives = 28/32 (87%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWC 431
LDA ADGSSFICL+CGGL S RKDEH+AYWC
Sbjct: 144 LDAFADGSSFICLKCGGLFSTSRKDEHLAYWC 175


>tr|B6U5J3|B6U5J3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 172

Score = 61.2 bits (147), Expect = 3e-08
Identities = 26/32 (81%), Positives = 28/32 (87%)
Frame = -1

Query: 526 LDASADGSSFICLQCGGLVSGHRKDEHIAYWC 431
LDA ADGSSFICL+CGGL S RKDEH+AYWC
Sbjct: 138 LDAFADGSSFICLKCGGLFSTSRKDEHLAYWC 169


>tr|A9SW11|A9SW11_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_18870 PE=4 SV=1
Length = 147

Score = 61.2 bits (147), Expect = 3e-08
Identities = 24/32 (75%), Positives = 29/32 (90%)
Frame = -1

Query: 523 DASADGSSFICLQCGGLVSGHRKDEHIAYWCS 428
DASADGSSF+C QCGG+VS R+DEH++YWCS
Sbjct: 116 DASADGSSFLCQQCGGVVSNSRRDEHLSYWCS 147