BP914804
Clone id YMU001_000063_A10
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTGAAGGTTTTAGACCTCCCGAAGTCACATATGTGCAGGCAGCCCAGATGTGAACAGAT
GCAGCTTAAGTGTGATTCTATAGCAGCAATTGGGTTGCTGAATGCTCTGCATCAAAGTCG
TTCAGTTATGCTTTGATTCTTCTCTCTCTAATATGAATGGTTCATTAAAATATCCACCCC
AACCCTAACTCTAGCATGACAAAAAAGACAACCATGCAAACAATGGGCATAGCTATTACC
TTGTAAACTCTTCAAAGACCTTCCTGATACTTCAGTATCACGAAACATCCACAAAAAGTA
ACTCCCCAAATGCTGTCATTCAAAATACCAAGGTCGTTCCACAAAACAGCTCATCAAAGT
TGCCCACATTTGACCTGCACCTAAGGGAATGTTGCTAAACTTTACTTACCCAACATCAAA
GGTACTGCAGCCTTTGTAACCCTAGTATTCTGGAGCCTTAGGTACACTAACTCAAAAGGC
TTCCATTGCTCCAATAAATTGTGTGTATGGTCAGAACATTCAGTGCTGAA
■■Homology search results ■■ -
sp_hit_id Q58366
Definition sp|Q58366|Y956_METJA Uncharacterized protein MJ0956 OS=Methanocaldococcus jannaschii
Align length 48
Score (bit) 30.0
E-value 7.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914804|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_A10.
(530 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q58366|Y956_METJA Uncharacterized protein MJ0956 OS=Methanoca... 30 7.2
sp|Q77Z83|IE2_HHV6U Immediate-early protein 2 OS=Human herpesvir... 30 7.2
sp|Q8BN78|KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus mus... 30 9.4
sp|Q86T24|KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sa... 30 9.4

>sp|Q58366|Y956_METJA Uncharacterized protein MJ0956
OS=Methanocaldococcus jannaschii GN=MJ0956 PE=4 SV=1
Length = 260

Score = 30.0 bits (66), Expect = 7.2
Identities = 12/48 (25%), Positives = 25/48 (52%)
Frame = -3

Query: 261 RSLKSLQGNSYAHCLHGCLFCHARVRVGVDILMNHSY*REKNQSITER 118
+ +SL N + C H C+FC ++G ++ + + ++K + ER
Sbjct: 148 KEFESLDKNLISSCYHACVFCPILYKLGKSLIKSEIFYKKKILTDNER 195


>sp|Q77Z83|IE2_HHV6U Immediate-early protein 2 OS=Human herpesvirus
6A (strain Uganda-1102) GN=U90/U87/U86 PE=2 SV=2
Length = 1500

Score = 30.0 bits (66), Expect = 7.2
Identities = 22/90 (24%), Positives = 36/90 (40%), Gaps = 3/90 (3%)
Frame = +3

Query: 195 HDKKDNHANNGHSYYLVNSSKTFLILQYHETSTKSNSPNAVIQNTKVVPQNSS---SKLP 365
HD KDN+ HS S K H+ + + N + T P++ + S
Sbjct: 545 HDSKDNYPKMKHSPGRTTSKKNTTNSNGHQNFKEVSVKNVSGKATSTSPKSKTHHYSSSS 604

Query: 366 TFDLHLRECC*TLLTQHQRYCSLCNPSILE 455
+ + T++ YC L NPSI++
Sbjct: 605 DEEGQYKSPVKTIIQSPSPYCKLKNPSIMD 634


>sp|Q8BN78|KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus
musculus GN=Zbtb33 PE=1 SV=1
Length = 671

Score = 29.6 bits (65), Expect = 9.4
Identities = 12/26 (46%), Positives = 18/26 (69%)
Frame = +3

Query: 297 SNSPNAVIQNTKVVPQNSSSKLPTFD 374
S+SP++ + NT +VPQ +SK T D
Sbjct: 341 SSSPDSAVSNTSLVPQADNSKSTTLD 366


>sp|Q86T24|KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo
sapiens GN=ZBTB33 PE=1 SV=2
Length = 672

Score = 29.6 bits (65), Expect = 9.4
Identities = 12/31 (38%), Positives = 21/31 (67%)
Frame = +3

Query: 282 ETSTKSNSPNAVIQNTKVVPQNSSSKLPTFD 374
+ T S+SP++ + NT +VPQ +S+ +FD
Sbjct: 338 DDDTISSSPDSAVSNTSLVPQADTSQNTSFD 368


tr_hit_id Q5NG85
Definition tr|Q5NG85|Q5NG85_FRATT Amino acid antiporter OS=Francisella tularensis subsp. tularensis
Align length 45
Score (bit) 36.6
E-value 0.81
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914804|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_A10.
(530 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5NG85|Q5NG85_FRATT Amino acid antiporter OS=Francisella tula... 37 0.81
tr|Q2A2Y8|Q2A2Y8_FRATH Amino acid antiporter OS=Francisella tula... 37 0.81
tr|Q14HN7|Q14HN7_FRAT1 Amino acid antiporter OS=Francisella tula... 37 0.81
tr|Q0BLG5|Q0BLG5_FRATO APC family amino acid-polyamine-organocat... 37 0.81
tr|B0U0N9|B0U0N9_FRAP2 Amino acid antiporter OS=Francisella phil... 37 0.81
tr|A7NCS7|A7NCS7_FRATF Amino acid permease OS=Francisella tulare... 37 0.81
tr|A4IXS2|A4IXS2_FRATW Amino acid permease OS=Francisella tulare... 37 0.81
tr|A0Q671|A0Q671_FRATN Amino acid antiporter OS=Francisella tula... 37 0.81
tr|B4ATS7|B4ATS7_FRANO Membrane protein, putative OS=Francisella... 37 0.81
tr|A7YTS7|A7YTS7_FRATU Amino acid antiporter OS=Francisella tula... 37 0.81
tr|A7JLP4|A7JLP4_FRANO Amino acid antiporter OS=Francisella novi... 37 0.81
tr|A7JHJ1|A7JHJ1_FRANO Amino acid antiporter OS=Francisella novi... 37 0.81
tr|A7JCK4|A7JCK4_FRATT Amino acid antiporter OS=Francisella tula... 37 0.81
tr|A4KRY5|A4KRY5_FRATU Amino acid transporter OS=Francisella tul... 37 0.81
tr|B2SGP6|B2SGP6_FRATM Amino acid antiporter OS=Francisella tula... 35 2.4
tr|A0BDH2|A0BDH2_PARTE Chromosome undetermined scaffold_100, who... 34 5.3
tr|A9NPE1|A9NPE1_PICSI Putative uncharacterized protein OS=Picea... 33 6.9
tr|A1CRK2|A1CRK2_ASPCL RING finger domain protein, putative OS=A... 33 6.9

>tr|Q5NG85|Q5NG85_FRATT Amino acid antiporter OS=Francisella
tularensis subsp. tularensis GN=FTT0968c PE=4 SV=1
Length = 471

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 106 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNLKGLRVS 150


>tr|Q2A2Y8|Q2A2Y8_FRATH Amino acid antiporter OS=Francisella
tularensis subsp. holarctica (strain LVS) GN=FTL_1233
PE=4 SV=1
Length = 473

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 108 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNIKGLRVS 152


>tr|Q14HN7|Q14HN7_FRAT1 Amino acid antiporter OS=Francisella
tularensis subsp. tularensis (strain FSC 198)
GN=FTF0968c PE=4 SV=1
Length = 471

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 106 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNLKGLRVS 150


>tr|Q0BLG5|Q0BLG5_FRATO APC family amino acid-polyamine-organocation
transporter OS=Francisella tularensis subsp. holarctica
(strain OSU18) GN=FTH_1210 PE=4 SV=1
Length = 473

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 108 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNIKGLRVS 152


>tr|B0U0N9|B0U0N9_FRAP2 Amino acid antiporter OS=Francisella
philomiragia subsp. philomiragia (strain ATCC 25017)
GN=Fphi_1766 PE=4 SV=1
Length = 472

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 106 LTFIAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNLKGLRVS 150


>tr|A7NCS7|A7NCS7_FRATF Amino acid permease OS=Francisella
tularensis subsp. holarctica (strain FTA) GN=FTA_1305
PE=4 SV=1
Length = 473

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 108 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNIKGLRVS 152


>tr|A4IXS2|A4IXS2_FRATW Amino acid permease OS=Francisella
tularensis subsp. tularensis (strain WY96-3418)
GN=FTW_0870 PE=4 SV=1
Length = 473

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 108 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNLKGLRVS 152


>tr|A0Q671|A0Q671_FRATN Amino acid antiporter OS=Francisella
tularensis subsp. novicida (strain U112) GN=FTN_0848
PE=4 SV=1
Length = 473

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 108 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNLKGLRVS 152


>tr|B4ATS7|B4ATS7_FRANO Membrane protein, putative OS=Francisella
novicida FTE GN=FTE_1090 PE=4 SV=1
Length = 473

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 108 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNLKGLRVS 152


>tr|A7YTS7|A7YTS7_FRATU Amino acid antiporter OS=Francisella
tularensis subsp. holarctica FSC022 GN=FTAG_00446 PE=4
SV=1
Length = 471

Score = 36.6 bits (83), Expect = 0.81
Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
Frame = +1

Query: 370 LTCT*GNVAKLYLP----NIKGTAAFVTLVFWSLRYTNSKGFHCS 492
LT G +A L+ P NIK T F+T+VFWSL N KG S
Sbjct: 106 LTFLAGTIAYLFNPDFAQNIKFTIIFITVVFWSLTILNLKGLRVS 150