BP914827
Clone id YMU001_000063_C12
Library
Length 574
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGGGAGTTAGTTAGTCGCCGTGTGCTGGACTTGAGACAAAGACAGATGCGAAACCTATT
GCTTGCTCTCTGCGTCTCTCAAGGGGTTCCTATGATGACAATGGGTGATGAATATGCTCA
TACAAAGGGAGGAAACAACAATACATATTGTCATGACAACTATATAAACTATTTCAGATG
GGATAAGAAAGAGGCAGATACGACTGGGTTCTACCGCTTTACAAGACTATTGTTAAACTT
TCGGAGGGATTGCGAGAGTCTTGGGTTGTCGGAATTCCCAACAGGGGACAGATTGCAATG
GCATGGGAATTCCCCATACACTCCAGACTGGTCTAAAAAGAGCCGCTTTGTAGCATTCAC
ATTAGTTGATTCTAGTTACAAGGAGCTTTATATTGCTTTCAATGCTGGTCATTTGGCCAA
AATAGTGGCATTGCCTAAAAGACAGGGTTTCAAATGGCAGCCTTTGGTAGACACTAGCAA
GTGTTGTCCTTATGATTTCCTATCAGAAGACCTGCCAGACAAGGATATAGCAATTGCTCA
GTATGCCCACTTTGTGAAAAGCAATATCTATCGA
■■Homology search results ■■ -
sp_hit_id P45178
Definition sp|P45178|GLGX_HAEIN Glycogen operon protein glgX homolog OS=Haemophilus influenzae
Align length 143
Score (bit) 68.6
E-value 2.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914827|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_C12.
(574 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P45178|GLGX_HAEIN Glycogen operon protein glgX homolog OS=Hae... 69 2e-11
sp|Q8ZLG6|GLGX_SALTY Glycogen debranching enzyme OS=Salmonella t... 65 2e-10
sp|Q8Z234|GLGX_SALTI Glycogen debranching enzyme OS=Salmonella t... 65 2e-10
sp|A9MTV3|GLGX_SALPB Glycogen debranching enzyme OS=Salmonella p... 65 2e-10
sp|Q5PM07|GLGX_SALPA Glycogen debranching enzyme OS=Salmonella p... 65 2e-10
sp|Q57IT9|GLGX_SALCH Glycogen debranching enzyme OS=Salmonella c... 65 2e-10
sp|P0A4Y4|GLGX_MYCTU Glycogen operon protein glgX homolog OS=Myc... 65 2e-10
sp|P0A4Y5|GLGX_MYCBO Glycogen operon protein glgX homolog OS=Myc... 65 2e-10
sp|Q83J89|GLGX_SHIFL Glycogen debranching enzyme OS=Shigella fle... 65 3e-10
sp|Q0SZN3|GLGX_SHIF8 Glycogen debranching enzyme OS=Shigella fle... 65 3e-10
sp|Q3YW94|GLGX_SHISS Glycogen debranching enzyme OS=Shigella son... 62 2e-09
sp|Q32AV4|GLGX_SHIDS Glycogen debranching enzyme OS=Shigella dys... 62 2e-09
sp|Q31VJ2|GLGX_SHIBS Glycogen debranching enzyme OS=Shigella boy... 62 2e-09
sp|Q1R5J5|GLGX_ECOUT Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|P15067|GLGX_ECOLI Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|B1IP33|GLGX_ECOLC Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|Q8FCR8|GLGX_ECOL6 Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|Q0TC28|GLGX_ECOL5 Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|A1AGW4|GLGX_ECOK1 Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|A8A5P1|GLGX_ECOHS Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|Q8X6X8|GLGX_ECO57 Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|A7ZSW4|GLGX_ECO24 Glycogen debranching enzyme OS=Escherichia ... 62 2e-09
sp|A8AQY2|GLGX_CITK8 Glycogen debranching enzyme OS=Citrobacter ... 62 2e-09
sp|P26501|ISOA_PSEUM Isoamylase OS=Pseudomonas sp. (strain SMP1)... 60 6e-09
sp|P10342|ISOA_PSEAY Isoamylase OS=Pseudomonas amyloderamosa GN=... 60 6e-09
sp|A1JSI8|GLGX_YERE8 Glycogen debranching enzyme OS=Yersinia ent... 59 1e-08
sp|Q8KR69|GLGX_ERWCH Glycogen debranching enzyme OS=Erwinia chry... 59 2e-08
sp|Q664I3|GLGX_YERPS Glycogen debranching enzyme OS=Yersinia pse... 57 9e-08
sp|A4TQV1|GLGX_YERPP Glycogen debranching enzyme OS=Yersinia pes... 57 9e-08
sp|Q1CDL4|GLGX_YERPN Glycogen debranching enzyme OS=Yersinia pes... 57 9e-08

>sp|P45178|GLGX_HAEIN Glycogen operon protein glgX homolog
OS=Haemophilus influenzae GN=glgX PE=3 SV=1
Length = 659

Score = 68.6 bits (166), Expect = 2e-11
Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 3/143 (2%)
Frame = +2

Query: 56 LLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEADTTGFYRFTRLLL 235
LL++L ++ G PM+ GDE+ +T+ GNNN YC DN I + +W + + T+ +
Sbjct: 503 LLMSLLLANGTPMLLAGDEFGNTQYGNNNAYCQDNEITWLKWANFNEE---LFELTKQTI 559

Query: 236 NFRRDCESLGLSEFPTGDRLQW---HGNSPYTPDWSKKSRFVAFTLVDSSYKELYIAFNA 406
R+ SL ++ + + +QW G DW + ++D+ + + NA
Sbjct: 560 ALRKQIGSLNKDQWWSDENVQWLNIVGEPMTVEDWQNQQTKALQVVLDNRW---LLLINA 616

Query: 407 GHLAKIVALPKRQGFKWQPLVDT 475
++ LP R KW+P + T
Sbjct: 617 KAEGQMFHLPNR---KWKPQIGT 636


>sp|Q8ZLG6|GLGX_SALTY Glycogen debranching enzyme OS=Salmonella
typhimurium GN=glgX PE=3 SV=1
Length = 658

Score = 65.1 bits (157), Expect = 2e-10
Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 8/146 (5%)
Frame = +2

Query: 26 LDLRQRQ---MRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEA 196
LDL +R+ + LL L +SQG PM+ GDE+ H++ GNNN YC DN + + W +
Sbjct: 486 LDLMERRRDSIHALLATLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNALTWLDWQQA-- 543

Query: 197 DTTGFYRFTRLLLNFRRDCESL-GLSEFPTGD-RLQWHGNS--PYTPD-WSKKSRFVAFT 361
G FT L+ R+ +L G S + GD ++W + P + D W + +
Sbjct: 544 -NRGLTTFTAALIRLRQQIPALTGNSWWEEGDGNVRWLNKNAQPLSADEWQNGPKLMQIL 602

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPK 439
L D IA NA + LP+
Sbjct: 603 LSD----RFLIAINATLEVTDIVLPE 624


>sp|Q8Z234|GLGX_SALTI Glycogen debranching enzyme OS=Salmonella
typhi GN=glgX PE=3 SV=1
Length = 654

Score = 65.1 bits (157), Expect = 2e-10
Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 8/146 (5%)
Frame = +2

Query: 26 LDLRQRQ---MRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEA 196
LDL +R+ + LL L +SQG PM+ GDE+ H++ GNNN YC DN + + W +
Sbjct: 486 LDLMERRRDSIHALLATLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNALTWLDWQQA-- 543

Query: 197 DTTGFYRFTRLLLNFRRDCESL-GLSEFPTGD-RLQWHGNS--PYTPD-WSKKSRFVAFT 361
G FT L+ R+ +L G S + GD ++W + P + D W + +
Sbjct: 544 -NRGLTTFTAALIRLRQQIPALTGNSWWEEGDGNVRWLNKNAQPLSADEWQNGPKLMQIL 602

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPK 439
L D IA NA + LP+
Sbjct: 603 LSD----RFLIAINATLEVTDIVLPE 624


>sp|A9MTV3|GLGX_SALPB Glycogen debranching enzyme OS=Salmonella
paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glgX PE=3
SV=1
Length = 658

Score = 65.1 bits (157), Expect = 2e-10
Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 8/146 (5%)
Frame = +2

Query: 26 LDLRQRQ---MRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEA 196
LDL +R+ + LL L +SQG PM+ GDE+ H++ GNNN YC DN + + W +
Sbjct: 486 LDLMERRRDSIHALLATLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNALTWLDWQQA-- 543

Query: 197 DTTGFYRFTRLLLNFRRDCESL-GLSEFPTGD-RLQWHGNS--PYTPD-WSKKSRFVAFT 361
G FT L+ R+ +L G S + GD ++W + P + D W + +
Sbjct: 544 -NRGLTTFTAALIRLRQQIPALTGNSWWEEGDGNVRWLNKNAQPLSADEWQNGPKLMQIL 602

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPK 439
L D IA NA + LP+
Sbjct: 603 LSD----RFLIAINATLEVTDIVLPE 624


>sp|Q5PM07|GLGX_SALPA Glycogen debranching enzyme OS=Salmonella
paratyphi A GN=glgX PE=3 SV=1
Length = 658

Score = 65.1 bits (157), Expect = 2e-10
Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 8/146 (5%)
Frame = +2

Query: 26 LDLRQRQ---MRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEA 196
LDL +R+ + LL L +SQG PM+ GDE+ H++ GNNN YC DN + + W +
Sbjct: 486 LDLMERRRDSIHALLATLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNALTWLDWQQA-- 543

Query: 197 DTTGFYRFTRLLLNFRRDCESL-GLSEFPTGD-RLQWHGNS--PYTPD-WSKKSRFVAFT 361
G FT L+ R+ +L G S + GD ++W + P + D W + +
Sbjct: 544 -NRGLTTFTAALIRLRQQIPALTGNSWWEEGDGNVRWLNKNAQPLSADEWQNGPKLMQIL 602

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPK 439
L D IA NA + LP+
Sbjct: 603 LSD----RFLIAINATLEVTDIVLPE 624


>sp|Q57IT9|GLGX_SALCH Glycogen debranching enzyme OS=Salmonella
choleraesuis GN=glgX PE=3 SV=1
Length = 658

Score = 65.1 bits (157), Expect = 2e-10
Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 8/146 (5%)
Frame = +2

Query: 26 LDLRQRQ---MRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEA 196
LDL +R+ + LL L +SQG PM+ GDE+ H++ GNNN YC DN + + W +
Sbjct: 486 LDLMERRRDSIHALLATLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNALTWLDWQQA-- 543

Query: 197 DTTGFYRFTRLLLNFRRDCESL-GLSEFPTGD-RLQWHGNS--PYTPD-WSKKSRFVAFT 361
G FT L+ R+ +L G S + GD ++W + P + D W + +
Sbjct: 544 -NRGLTTFTAALIRLRQQIPALTGNSWWEEGDGNVRWLNKNAQPLSADEWQNGPKLMQIL 602

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPK 439
L D IA NA + LP+
Sbjct: 603 LSD----RFLIAINATLEVTDIVLPE 624


>sp|P0A4Y4|GLGX_MYCTU Glycogen operon protein glgX homolog
OS=Mycobacterium tuberculosis GN=glgX PE=3 SV=1
Length = 721

Score = 65.1 bits (157), Expect = 2e-10
Identities = 32/67 (47%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
Frame = +2

Query: 23 VLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWD--KKEA 196
+L LR RQMRN+ L VSQG PM+ GDE T+ GNNN YC D+ +++ W K A
Sbjct: 515 ILALRARQMRNMWATLMVSQGTPMIAHGDEIGRTQYGNNNVYCQDSELSWMDWSLVDKNA 574

Query: 197 DTTGFYR 217
D F R
Sbjct: 575 DLLAFAR 581


>sp|P0A4Y5|GLGX_MYCBO Glycogen operon protein glgX homolog
OS=Mycobacterium bovis GN=glgX PE=3 SV=1
Length = 721

Score = 65.1 bits (157), Expect = 2e-10
Identities = 32/67 (47%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
Frame = +2

Query: 23 VLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWD--KKEA 196
+L LR RQMRN+ L VSQG PM+ GDE T+ GNNN YC D+ +++ W K A
Sbjct: 515 ILALRARQMRNMWATLMVSQGTPMIAHGDEIGRTQYGNNNVYCQDSELSWMDWSLVDKNA 574

Query: 197 DTTGFYR 217
D F R
Sbjct: 575 DLLAFAR 581


>sp|Q83J89|GLGX_SHIFL Glycogen debranching enzyme OS=Shigella
flexneri GN=glgX PE=3 SV=1
Length = 657

Score = 64.7 bits (156), Expect = 3e-10
Identities = 42/143 (29%), Positives = 70/143 (48%), Gaps = 5/143 (3%)
Frame = +2

Query: 23 VLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEADT 202
+++ R+ + LL L +SQG PM+ GDE+ H++ GNNN YC DN +N+ W + +
Sbjct: 488 LVERRRDSIHALLTTLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNQLNWLDWSQA---S 544

Query: 203 TGFYRFTRLLLNFRRDCESLGLSE-FPTGD-RLQW---HGNSPYTPDWSKKSRFVAFTLV 367
+G FT L++ R+ +L + + GD ++W + T +W + + L
Sbjct: 545 SGLTAFTAALIHLRKRIPALVENRWWEEGDGNVRWLNRYAQPLSTDEWQNGPKQLQILLS 604

Query: 368 DSSYKELYIAFNAGHLAKIVALP 436
D IA NA + LP
Sbjct: 605 D----RFLIAINATLEVTEIVLP 623


>sp|Q0SZN3|GLGX_SHIF8 Glycogen debranching enzyme OS=Shigella
flexneri serotype 5b (strain 8401) GN=glgX PE=3 SV=1
Length = 657

Score = 64.7 bits (156), Expect = 3e-10
Identities = 42/143 (29%), Positives = 70/143 (48%), Gaps = 5/143 (3%)
Frame = +2

Query: 23 VLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRWDKKEADT 202
+++ R+ + LL L +SQG PM+ GDE+ H++ GNNN YC DN +N+ W + +
Sbjct: 488 LVERRRDSIHALLTTLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNQLNWLDWSQA---S 544

Query: 203 TGFYRFTRLLLNFRRDCESLGLSE-FPTGD-RLQW---HGNSPYTPDWSKKSRFVAFTLV 367
+G FT L++ R+ +L + + GD ++W + T +W + + L
Sbjct: 545 SGLTAFTAALIHLRKRIPALVENRWWEEGDGNVRWLNRYAQPLSTDEWQNGPKQLQILLS 604

Query: 368 DSSYKELYIAFNAGHLAKIVALP 436
D IA NA + LP
Sbjct: 605 D----RFLIAINATLEVTEIVLP 623


tr_hit_id A4PIS8
Definition tr|A4PIS8|A4PIS8_PHAVU Isoamylase-type starch-debranching enzyme 1 OS=Phaseolus vulgaris
Align length 190
Score (bit) 274.0
E-value 2.0e-72
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914827|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_C12.
(574 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A4PIS8|A4PIS8_PHAVU Isoamylase-type starch-debranching enzyme... 274 2e-72
tr|Q105A2|Q105A2_PEA Isoamylase isoform 1 OS=Pisum sativum PE=2 ... 271 2e-71
tr|A5BDB8|A5BDB8_VITVI Putative uncharacterized protein OS=Vitis... 268 1e-70
tr|B6U0X5|B6U0X5_MAIZE Isoamylase OS=Zea mays PE=2 SV=1 265 1e-69
tr|Q41742|Q41742_MAIZE Su1p (Fragment) OS=Zea mays GN=Sugary1 PE... 265 1e-69
tr|O22637|O22637_MAIZE SU1 isoamylase OS=Zea mays GN=sugary1 PE=... 265 1e-69
tr|O04196|O04196_ARATH Putative isoamylase (At2g39930) OS=Arabid... 265 1e-69
tr|Q84YG7|Q84YG7_SOLTU Isoamylase isoform 1 OS=Solanum tuberosum... 264 2e-69
tr|A9RYH5|A9RYH5_PHYPA Predicted protein OS=Physcomitrella paten... 264 2e-69
tr|Q1AJM7|Q1AJM7_IPOBA Isoamylase OS=Ipomoea batatas PE=2 SV=1 261 2e-68
tr|Q8VWM4|Q8VWM4_HORVU Isoamylase OS=Hordeum vulgare GN=hviso1 P... 254 2e-66
tr|Q8LKZ7|Q8LKZ7_HORVU Isoamylase OS=Hordeum vulgare PE=2 SV=1 254 2e-66
tr|B8B8U4|B8B8U4_ORYSI Putative uncharacterized protein OS=Oryza... 253 5e-66
tr|Q0J4C6|Q0J4C6_ORYSJ Os08g0520900 protein (Fragment) OS=Oryza ... 252 1e-65
tr|A3BUX8|A3BUX8_ORYSJ Putative uncharacterized protein OS=Oryza... 252 1e-65
tr|Q8VWM3|Q8VWM3_WHEAT Isoamylase OS=Triticum aestivum GN=iso1 P... 250 3e-65
tr|Q7XA16|Q7XA16_AEGTA Isoamylase OS=Aegilops tauschii PE=4 SV=1 249 8e-65
tr|Q7XA15|Q7XA15_WHEAT Isoamylase wDBE-D1 OS=Triticum aestivum P... 249 8e-65
tr|Q8VWN0|Q8VWN0_WHEAT Isoamylase (Fragment) OS=Triticum aestivu... 248 2e-64
tr|Q8W547|Q8W547_WHEAT Isoamylase OS=Triticum aestivum PE=2 SV=1 246 8e-64
tr|Q84L53|Q84L53_ORYSJ Isoamylase OS=Oryza sativa subsp. japonic... 238 2e-61
tr|O80403|O80403_ORYSA Isoamylase (Fragment) OS=Oryza sativa PE=... 238 2e-61
tr|Q7X8Q2|Q7X8Q2_CHLRE Isoamylase OS=Chlamydomonas reinhardtii G... 197 3e-49
tr|A8J7L5|A8J7L5_CHLRE Isoamylase, starch debranching enzyme OS=... 197 3e-49
tr|A0T350|A0T350_SORBI Isoamylase type debranching enzyme (Fragm... 184 3e-45
tr|A4SB91|A4SB91_OSTLU Predicted protein OS=Ostreococcus lucimar... 168 2e-40
tr|Q6PYZ2|Q6PYZ2_OSTTA DBEI (Isoamylase) (IC) OS=Ostreococcus ta... 163 7e-39
tr|Q6MC69|Q6MC69_PARUW Probable isoamylase OS=Protochlamydia amo... 155 1e-36
tr|A4S5A6|A4S5A6_OSTLU Predicted protein OS=Ostreococcus lucimar... 129 1e-28
tr|Q84YG5|Q84YG5_SOLTU Isoamylase isoform 3 OS=Solanum tuberosum... 123 8e-27

>tr|A4PIS8|A4PIS8_PHAVU Isoamylase-type starch-debranching enzyme 1
OS=Phaseolus vulgaris GN=PvISA1 PE=2 SV=1
Length = 791

Score = 274 bits (701), Expect = 2e-72
Identities = 124/190 (65%), Positives = 152/190 (80%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE VS V LR+RQMRNL L+L VSQGVPM+ MGDEY HTKGGNNNTYCHDNY+NYF+W
Sbjct: 584 GEFVSTSVKKLRKRQMRNLFLSLMVSQGVPMIYMGDEYGHTKGGNNNTYCHDNYLNYFQW 643

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKKE ++ F+RF L+ FR++CESLGL +FPT +RLQWHG+ P PDWS+ SRFVAFT
Sbjct: 644 DKKEESSSDFFRFCCLVTKFRQECESLGLDDFPTSERLQWHGHFPGMPDWSETSRFVAFT 703

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
LVDS E+Y+AFN HL + LP+R G++W+PLVDTSK P+DFL+ DLP +DIAI Q
Sbjct: 704 LVDSVKGEIYVAFNMSHLPFTITLPERPGYRWEPLVDTSKPIPFDFLTPDLPGRDIAIQQ 763

Query: 542 YAHFVKSNIY 571
YAHF+ +N+Y
Sbjct: 764 YAHFLDANMY 773


>tr|Q105A2|Q105A2_PEA Isoamylase isoform 1 OS=Pisum sativum PE=2 SV=1
Length = 791

Score = 271 bits (693), Expect = 2e-71
Identities = 125/190 (65%), Positives = 149/190 (78%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE VS V LR+RQMRN L+L VSQGVPM+ MG EY HTKGGNNNTYCHDNY+NYF+W
Sbjct: 584 GEFVSASVKKLRKRQMRNFFLSLMVSQGVPMIHMGYEYGHTKGGNNNTYCHDNYLNYFQW 643

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKKE ++ F+RF LL+ FR++CESLGL +FPT +RLQ HG P TPDWS+ SRFVAFT
Sbjct: 644 DKKEESSSDFFRFCSLLIKFRQECESLGLDDFPTSERLQGHGLFPVTPDWSETSRFVAFT 703

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
LVDS E+YIAFN HL V LP+R G++W+PL+DTSK PYDFL+ DLP +DIAI Q
Sbjct: 704 LVDSVKGEIYIAFNTSHLPFTVTLPERPGYRWEPLIDTSKSAPYDFLTPDLPGRDIAIQQ 763

Query: 542 YAHFVKSNIY 571
YAHF+ N+Y
Sbjct: 764 YAHFLDVNMY 773


>tr|A5BDB8|A5BDB8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_027248 PE=4 SV=1
Length = 512

Score = 268 bits (686), Expect = 1e-70
Identities = 120/190 (63%), Positives = 148/190 (77%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE S V LR+RQMRN L L VSQGVPM+ MGDEY HTKGGNNNTYC DNY+NYFRW
Sbjct: 304 GEFASISVKKLRKRQMRNFFLCLMVSQGVPMIYMGDEYGHTKGGNNNTYCXDNYMNYFRW 363

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKKE + F+RF L+ FR++CESLGL++FPT +RLQWHG +P PDWSK SRFVAFT
Sbjct: 364 DKKEESLSDFFRFCCLMSKFRQECESLGLNDFPTAERLQWHGRTPGMPDWSKTSRFVAFT 423

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
+VDS E+Y+AFN HL I+ LP+R G++WQPLVDTSK P+DFLS D+P++D A+ Q
Sbjct: 424 MVDSVKGEIYVAFNTSHLPIIITLPERPGYRWQPLVDTSKPAPFDFLSNDVPERDTAVKQ 483

Query: 542 YAHFVKSNIY 571
Y+ F ++N+Y
Sbjct: 484 YSQFTEANLY 493


>tr|B6U0X5|B6U0X5_MAIZE Isoamylase OS=Zea mays PE=2 SV=1
Length = 789

Score = 265 bits (678), Expect = 1e-69
Identities = 114/190 (60%), Positives = 146/190 (76%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE S V LR+RQMRN + L VSQGVPM MGDEY HTKGGNNNTYCHD+Y+NYFRW
Sbjct: 584 GEFASLSVRRLRKRQMRNFFVCLMVSQGVPMFYMGDEYGHTKGGNNNTYCHDHYVNYFRW 643

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKKE ++ YRF RL+ FR++CESLGL +FPT +RL+WHG+ P PDWS+ SRFVAFT
Sbjct: 644 DKKEEQSSDLYRFCRLMTKFRKECESLGLEDFPTSERLKWHGHQPEKPDWSEASRFVAFT 703

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
+ D + E+Y+AFN HL +V LP+R GF+W+P+VDT K PYDFL++ LPD+ + + Q
Sbjct: 704 MKDETKGEIYVAFNTSHLPVVVGLPERSGFRWEPVVDTGKEAPYDFLTDGLPDRAVTVYQ 763

Query: 542 YAHFVKSNIY 571
++HF+ SN+Y
Sbjct: 764 FSHFLNSNLY 773


>tr|Q41742|Q41742_MAIZE Su1p (Fragment) OS=Zea mays GN=Sugary1 PE=2
SV=1
Length = 818

Score = 265 bits (677), Expect = 1e-69
Identities = 114/190 (60%), Positives = 146/190 (76%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE S V LR+RQMRN + L VSQGVPM MGDEY HTKGGNNNTYCHD+Y+NYFRW
Sbjct: 613 GEFASLSVRRLRKRQMRNFFVCLMVSQGVPMFYMGDEYGHTKGGNNNTYCHDHYVNYFRW 672

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKKE ++ YRF RL+ FR++CESLGL +FPT +RL+WHG+ P PDWS+ SRFVAFT
Sbjct: 673 DKKEEQSSDLYRFCRLMTEFRKECESLGLEDFPTSERLKWHGHQPGKPDWSEASRFVAFT 732

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
+ D + E+Y+AFN HL +V LP+R GF+W+P+VDT K PYDFL++ LPD+ + + Q
Sbjct: 733 MKDETKGEIYVAFNTSHLPVVVGLPERSGFRWEPVVDTGKEAPYDFLTDGLPDRAVTVYQ 792

Query: 542 YAHFVKSNIY 571
++HF+ SN+Y
Sbjct: 793 FSHFLNSNLY 802


>tr|O22637|O22637_MAIZE SU1 isoamylase OS=Zea mays GN=sugary1 PE=4
SV=1
Length = 789

Score = 265 bits (677), Expect = 1e-69
Identities = 114/190 (60%), Positives = 146/190 (76%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE S V LR+RQMRN + L VSQGVPM MGDEY HTKGGNNNTYCHD+Y+NYFRW
Sbjct: 584 GEFASLSVRRLRKRQMRNFFVCLMVSQGVPMFYMGDEYGHTKGGNNNTYCHDHYVNYFRW 643

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKKE ++ YRF RL+ FR++CESLGL +FPT +RL+WHG+ P PDWS+ SRFVAFT
Sbjct: 644 DKKEEQSSDLYRFCRLMTKFRKECESLGLEDFPTSERLKWHGHQPGKPDWSEASRFVAFT 703

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
+ D + E+Y+AFN HL +V LP+R GF+W+P+VDT K PYDFL++ LPD+ + + Q
Sbjct: 704 MKDETKGEIYVAFNTSHLPVVVGLPERSGFRWEPVVDTGKEAPYDFLTDGLPDRAVTVYQ 763

Query: 542 YAHFVKSNIY 571
++HF+ SN+Y
Sbjct: 764 FSHFLNSNLY 773


>tr|O04196|O04196_ARATH Putative isoamylase (At2g39930) OS=Arabidopsis
thaliana GN=At2g39930 PE=2 SV=1
Length = 783

Score = 265 bits (677), Expect = 1e-69
Identities = 117/190 (61%), Positives = 150/190 (78%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
G+ S V LR+RQMRN ++L VSQGVPM+ MGDEY HTKGGNNNTYCHDNY+NYFRW
Sbjct: 576 GDFASISVKRLRKRQMRNFFVSLMVSQGVPMIYMGDEYGHTKGGNNNTYCHDNYMNYFRW 635

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKKE + F+RF R+L+ FR +CESLGL++FPT RLQWHG +P P+WS+ SRFVAF+
Sbjct: 636 DKKEEAHSDFFRFCRILIKFRDECESLGLNDFPTAKRLQWHGLAPEIPNWSETSRFVAFS 695

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
LVDS KE+Y+AFN HLA +V+LP R G++W+P VDTSK PYD ++ DLP+++ A+ Q
Sbjct: 696 LVDSVKKEIYVAFNTSHLATLVSLPNRPGYRWEPFVDTSKPSPYDCITPDLPERETAMKQ 755

Query: 542 YAHFVKSNIY 571
Y HF+ +N+Y
Sbjct: 756 YRHFLDANVY 765


>tr|Q84YG7|Q84YG7_SOLTU Isoamylase isoform 1 OS=Solanum tuberosum PE=2
SV=1
Length = 793

Score = 264 bits (675), Expect = 2e-69
Identities = 120/190 (63%), Positives = 144/190 (75%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE S V LR+RQMRN L L VSQGVPM+ MGDEY HTKGGNNNTYCHDNYINYFRW
Sbjct: 586 GEFASIFVKKLRKRQMRNFFLCLMVSQGVPMIYMGDEYGHTKGGNNNTYCHDNYINYFRW 645

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKK+ ++ F RF L+ FR +CESLGL FPT +RLQWHG++P TPDWS+ SRFVAFT
Sbjct: 646 DKKDESSSDFLRFCGLMTKFRHECESLGLDGFPTAERLQWHGHTPRTPDWSETSRFVAFT 705

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
LVD ELYIAFNA HL + LP R G++WQP VDT K P+DFL++D+P+++ A Q
Sbjct: 706 LVDKVKGELYIAFNASHLPVTITLPDRPGYRWQPFVDTGKPAPFDFLTDDVPERETAAKQ 765

Query: 542 YAHFVKSNIY 571
Y+HF+ +N Y
Sbjct: 766 YSHFLDANQY 775


>tr|A9RYH5|A9RYH5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_179583 PE=4 SV=1
Length = 828

Score = 264 bits (675), Expect = 2e-69
Identities = 123/190 (64%), Positives = 147/190 (77%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
GE+VS V LRQRQ+RN +AL VSQGVPM+TMGDEY HTKGGNNNTYCHDN+INYFRW
Sbjct: 621 GEVVSIPVQRLRQRQLRNFFVALMVSQGVPMITMGDEYGHTKGGNNNTYCHDNFINYFRW 680

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
D K AD GF+RF L++NFR E L L +F TGDRL+WHG P TPDW++ S+FVAFT
Sbjct: 681 DMKRADPNGFHRFASLMMNFRSGTECLRLGDFLTGDRLEWHGIFPNTPDWTESSKFVAFT 740

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
LVD +ELYIAFNA HL +V LP R G KW PLVDTSK PYDFL +D+P+ D+ +AQ
Sbjct: 741 LVDQQKRELYIAFNASHLPVMVTLPDRVGAKWYPLVDTSKPTPYDFLVDDVPNIDVVLAQ 800

Query: 542 YAHFVKSNIY 571
++F+ SN+Y
Sbjct: 801 TSNFLNSNLY 810


>tr|Q1AJM7|Q1AJM7_IPOBA Isoamylase OS=Ipomoea batatas PE=2 SV=1
Length = 785

Score = 261 bits (667), Expect = 2e-68
Identities = 119/190 (62%), Positives = 144/190 (75%)
Frame = +2

Query: 2 GELVSRRVLDLRQRQMRNLLLALCVSQGVPMMTMGDEYAHTKGGNNNTYCHDNYINYFRW 181
G S V LR+RQMRN L L VSQGVPM+ MGDEY HTKGGNNNTYCHDNYINYFRW
Sbjct: 575 GGFASISVKKLRKRQMRNFFLCLMVSQGVPMIYMGDEYGHTKGGNNNTYCHDNYINYFRW 634

Query: 182 DKKEADTTGFYRFTRLLLNFRRDCESLGLSEFPTGDRLQWHGNSPYTPDWSKKSRFVAFT 361
DKK+ +T F+RF + FR + ESLGL +FPT +RLQWHG++P PDWS+ SRFVAFT
Sbjct: 635 DKKDESSTDFFRFCCHVTKFRHEAESLGLDDFPTAERLQWHGHTPGMPDWSESSRFVAFT 694

Query: 362 LVDSSYKELYIAFNAGHLAKIVALPKRQGFKWQPLVDTSKCCPYDFLSEDLPDKDIAIAQ 541
LVD E+YIAFNA HL V LP+R G++W+PLVDT K P+DFL +D+P+K A+ Q
Sbjct: 695 LVDKVKGEIYIAFNASHLPVTVTLPERGGYRWEPLVDTGKQTPFDFLGDDVPEKKTALKQ 754

Query: 542 YAHFVKSNIY 571
YAHF+ +N+Y
Sbjct: 755 YAHFLDANMY 764