BP914839
Clone id YMU001_000063_D12
Library
Length 354
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_D12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCAGAATGCTCACAAGAATCATCCCCCTTATCCATTACAGGTTTCCCAATTAGATGTGG
AAGAGGTCCTTCCTCTTTCAACTTTCTAAAGTACCTCGTCAAGCCTTGACATAGATTTCC
TGACTTCTTGGATGACCCCAGCCTCCAACTACAAACGTATGCACCTCATTATTAACTTCA
ATGTACGACCTTCCTGGTACTTTCCATGCCTTCAGTGACAGGCGAAGCTGCTCCAATCGC
CTTGCATTTGCCTGCTCACCAACAAGAGAATATATCTTTGACATCAGGACATAACCAACA
CTATTCAGGGGCTCAATGGTGACAACCCTCTCGAAGCAGCGTCTTCCAACTACC
■■Homology search results ■■ -
sp_hit_id Q9FND6
Definition sp|Q9FND6|PP411_ARATH Pentatricopeptide repeat-containing protein At5g40410, mitochondrial OS=Arabidopsis thaliana
Align length 82
Score (bit) 64.7
E-value 1.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914839|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_D12.
(354 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FND6|PP411_ARATH Pentatricopeptide repeat-containing protei... 65 1e-10
sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protei... 60 4e-09
sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protei... 59 6e-09
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 59 7e-09
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 57 3e-08
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 57 4e-08
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 56 5e-08
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 56 6e-08
sp|Q56XI1|PPR25_ARATH Pentatricopeptide repeat-containing protei... 55 8e-08
sp|Q9FMA1|PP433_ARATH Pentatricopeptide repeat-containing protei... 55 1e-07
sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protei... 54 2e-07
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 54 2e-07
sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protei... 54 2e-07
sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protei... 54 2e-07
sp|Q9SR82|PP219_ARATH Putative pentatricopeptide repeat-containi... 54 2e-07
sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protei... 53 4e-07
sp|Q9LXY5|PP284_ARATH Pentatricopeptide repeat-containing protei... 53 4e-07
sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protei... 53 4e-07
sp|Q9C501|PPR70_ARATH Pentatricopeptide repeat-containing protei... 52 7e-07
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 52 7e-07
sp|Q9SJK9|PP189_ARATH Pentatricopeptide repeat-containing protei... 52 9e-07
sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protei... 52 9e-07
sp|Q9M1V3|PP296_ARATH Pentatricopeptide repeat-containing protei... 52 1e-06
sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protei... 52 1e-06
sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protei... 51 2e-06
sp|Q9C8L6|PPR80_ARATH Pentatricopeptide repeat-containing protei... 50 3e-06
sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containi... 50 3e-06
sp|Q9FIF7|PP435_ARATH Putative pentatricopeptide repeat-containi... 50 3e-06
sp|Q9FND7|PP410_ARATH Putative pentatricopeptide repeat-containi... 50 3e-06
sp|Q9SN85|PP267_ARATH Pentatricopeptide repeat-containing protei... 50 3e-06

>sp|Q9FND6|PP411_ARATH Pentatricopeptide repeat-containing protein
At5g40410, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H15 PE=2 SV=1
Length = 608

Score = 64.7 bits (156), Expect = 1e-10
Identities = 32/82 (39%), Positives = 46/82 (56%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+G + ER+ +EP + YV++S IYS G +A R+ L + G SYIE
Sbjct: 422 LGTKAAERLFELEPRDGRNYVMLSNIYSASGLWKDASRIRNLMKQKGLVRASGCSYIEHG 481

Query: 170 NEVHTFVVGGWGHPRSQEIYVK 105
N++H FVVG W HP S++I K
Sbjct: 482 NKIHKFVVGDWSHPESEKIQKK 503


>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein
At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1
Length = 868

Score = 59.7 bits (143), Expect = 4e-09
Identities = 27/82 (32%), Positives = 48/82 (58%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+GR E+++ ++P +S YVL+S +Y+ G+ ++ +L K PG S+IEV
Sbjct: 682 LGRLAAEKIIAMKPEDSAAYVLLSNMYAESGDWQERAKVRKLMNERNVKKEPGYSWIEVK 741

Query: 170 NEVHTFVVGGWGHPRSQEIYVK 105
N+ ++F+ G HP +IY+K
Sbjct: 742 NKTYSFLAGDRSHPLKDQIYMK 763


>sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protein
At3g13880 OS=Arabidopsis thaliana GN=PCMP-E89 PE=2 SV=1
Length = 748

Score = 59.3 bits (142), Expect = 6e-09
Identities = 30/81 (37%), Positives = 45/81 (55%)
Frame = -2

Query: 353 VVGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEV 174
V+G+R ER++ +EP S YVL+ IY+ G ++A + +L K P S+I +
Sbjct: 645 VIGKRVAERLMELEPEASGSYVLLHNIYNDSGVNSSAEEVRELMRDRGVKKEPALSWIVI 704

Query: 173 NNEVHTFVVGGWGHPRSQEIY 111
N+ H+F V HP SQ IY
Sbjct: 705 GNQTHSFAVADLSHPSSQMIY 725


>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein
At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1
Length = 741

Score = 58.9 bits (141), Expect = 7e-09
Identities = 31/80 (38%), Positives = 44/80 (55%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+G E ++ IEP N YVL+S IY+ G + L KVPG S IE++
Sbjct: 556 LGESFAENLIKIEPENPGSYVLLSNIYASAGRWNEVAKTRALLNDKGMKKVPGCSSIEID 615

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
+ VH F++G HPR++EIY
Sbjct: 616 SVVHEFIIGDKFHPRNREIY 635


>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein
At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2
Length = 595

Score = 57.0 bits (136), Expect = 3e-08
Identities = 27/75 (36%), Positives = 45/75 (60%)
Frame = -2

Query: 329 RVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVNNEVHTFV 150
+++ +EP +S YVL+S +Y+ ++ +++ + L KVPG S +EV N VH F+
Sbjct: 417 QILQLEPNHSGDYVLLSNMYASEQRWSDVQKIRKQMLRDGVKKVPGHSLVEVGNRVHEFL 476

Query: 149 VGGWGHPRSQEIYVK 105
+G HP+S IY K
Sbjct: 477 MGDKSHPQSDAIYAK 491


>sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containing
protein At3g49140 OS=Arabidopsis thaliana GN=PCMP-H77
PE=3 SV=1
Length = 686

Score = 56.6 bits (135), Expect = 4e-08
Identities = 29/80 (36%), Positives = 42/80 (52%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+G +++ + P S YVL+S IY+ G + + S K PG S +EVN
Sbjct: 496 IGLLAADKLFQLAPEQSGYYVLLSNIYAKAGRWEEVTNIRNIMKSKGLKKNPGASNVEVN 555

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
+HTF+VG HP+S EIY
Sbjct: 556 RIIHTFLVGDRSHPQSDEIY 575


>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein
At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=2 SV=1
Length = 781

Score = 56.2 bits (134), Expect = 5e-08
Identities = 28/74 (37%), Positives = 41/74 (55%)
Frame = -2

Query: 332 ERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVNNEVHTF 153
+++ +EP NS YVL+S +Y+ G + +L KVPG S+IE+ N+ HTF
Sbjct: 602 DKIFAMEPENSGMYVLLSNLYASSGRWGDVGKLRVRMRDKGVKKVPGYSWIEIQNKTHTF 661

Query: 152 VVGGWGHPRSQEIY 111
VG HP EI+
Sbjct: 662 SVGDEFHPEKDEIF 675


>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein
At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2
Length = 1064

Score = 55.8 bits (133), Expect = 6e-08
Identities = 30/81 (37%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKV-PGRSYIEV 174
+G ++ +EP +S YVL+S +Y+ V ++ +AR L + ++ K K PG+S+IEV
Sbjct: 879 IGEFAAHHLLELEPEDSATYVLLSNLYA-VSKKWDARDLTRQKMKEKGVKKEPGQSWIEV 937

Query: 173 NNEVHTFVVGGWGHPRSQEIY 111
N +H+F VG HP + EI+
Sbjct: 938 KNSIHSFYVGDQNHPLADEIH 958


>sp|Q56XI1|PPR25_ARATH Pentatricopeptide repeat-containing protein
At1g09410 OS=Arabidopsis thaliana GN=PCMP-H18 PE=2 SV=2
Length = 705

Score = 55.5 bits (132), Expect = 8e-08
Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
V C ++++ IEP NS Y+L+S +Y+ G A+ L +L + K PG S+ EV
Sbjct: 519 VAEFCAKKLIEIEPENSGTYILLSNMYASQGRWADVAELRKLMKTRLVRKSPGCSWTEVE 578

Query: 170 NEVHTFVVGGW-GHPRSQEI 114
N+VH F GG HP + I
Sbjct: 579 NKVHAFTRGGINSHPEQESI 598


>sp|Q9FMA1|PP433_ARATH Pentatricopeptide repeat-containing protein
At5g56310 OS=Arabidopsis thaliana GN=PCMP-E13 PE=2 SV=1
Length = 530

Score = 55.1 bits (131), Expect = 1e-07
Identities = 25/80 (31%), Positives = 44/80 (55%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+G R ++ +EP NS Y+L++ +YS +G +R + + + K+ G S IEV
Sbjct: 437 LGERALSELIKLEPNNSGNYMLLANLYSNLGRWDESRMMRNMMKGIGVKKMAGESSIEVE 496

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
N V+ F+ G HP+ + I+
Sbjct: 497 NRVYKFISGDLTHPQVERIH 516


tr_hit_id B3U1U5
Definition tr|B3U1U5|B3U1U5_ISOEN Pentatricopeptide repeat protein (Fragment) OS=Isoetes engelmannii
Align length 80
Score (bit) 85.5
E-value 1.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914839|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_D12.
(354 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3U1U5|B3U1U5_ISOEN Pentatricopeptide repeat protein (Fragmen... 86 1e-15
tr|B3U1U2|B3U1U2_ISOEN Pentatricopeptide repeat protein (Fragmen... 80 4e-14
tr|B3U1U3|B3U1U3_ISOEN Pentatricopeptide repeat protein (Fragmen... 77 3e-13
tr|B3U1P2|B3U1P2_9MARC Pentatricopeptide repeat protein (Fragmen... 67 3e-10
tr|A7QPS9|A7QPS9_VITVI Chromosome chr10 scaffold_138, whole geno... 67 3e-10
tr|A7PQD4|A7PQD4_VITVI Chromosome chr18 scaffold_24, whole genom... 67 3e-10
tr|A5B2K7|A5B2K7_VITVI Putative uncharacterized protein OS=Vitis... 67 3e-10
tr|B3U1N4|B3U1N4_9MARC Pentatricopeptide repeat protein (Fragmen... 67 4e-10
tr|Q6K2P5|Q6K2P5_ORYSJ Os09g0327200 protein OS=Oryza sativa subs... 66 7e-10
tr|Q1SN04|Q1SN04_MEDTR Tetratricopeptide-like helical OS=Medicag... 66 7e-10
tr|A3BXI2|A3BXI2_ORYSJ Putative uncharacterized protein OS=Oryza... 66 7e-10
tr|A2YZX1|A2YZX1_ORYSI Putative uncharacterized protein OS=Oryza... 66 7e-10
tr|B3U1P5|B3U1P5_9MARC Pentatricopeptide repeat protein (Fragmen... 65 2e-09
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 64 4e-09
tr|B8BMF2|B8BMF2_ORYSI Putative uncharacterized protein OS=Oryza... 63 6e-09
tr|A7QV49|A7QV49_VITVI Chromosome undetermined scaffold_185, who... 63 6e-09
tr|A7QV19|A7QV19_VITVI Chromosome undetermined scaffold_183, who... 63 6e-09
tr|A7QV08|A7QV08_VITVI Chromosome undetermined scaffold_183, who... 63 6e-09
tr|A7P886|A7P886_VITVI Chromosome chr3 scaffold_8, whole genome ... 63 6e-09
tr|Q6ZLQ1|Q6ZLQ1_ORYSJ Os07g0150000 protein OS=Oryza sativa subs... 63 8e-09
tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea... 63 8e-09
tr|A7PLK6|A7PLK6_VITVI Chromosome chr7 scaffold_20, whole genome... 63 8e-09
tr|A5BSF9|A5BSF9_VITVI Putative uncharacterized protein OS=Vitis... 63 8e-09
tr|A5AVY8|A5AVY8_VITVI Putative uncharacterized protein OS=Vitis... 63 8e-09
tr|A3BGL5|A3BGL5_ORYSJ Putative uncharacterized protein OS=Oryza... 63 8e-09
tr|B3U1U4|B3U1U4_ISOEN Pentatricopeptide repeat protein (Fragmen... 62 1e-08
tr|Q75LD1|Q75LD1_ORYSJ Os03g0844000 protein OS=Oryza sativa subs... 62 1e-08
tr|Q10AR1|Q10AR1_ORYSJ Pentatricopeptide, putative, expressed OS... 62 1e-08
tr|B8AN81|B8AN81_ORYSI Putative uncharacterized protein OS=Oryza... 62 1e-08
tr|B3U1P0|B3U1P0_9MARC Pentatricopeptide repeat protein (Fragmen... 62 1e-08

>tr|B3U1U5|B3U1U5_ISOEN Pentatricopeptide repeat protein (Fragment)
OS=Isoetes engelmannii GN=PPR PE=4 SV=1
Length = 143

Score = 85.5 bits (210), Expect = 1e-15
Identities = 38/80 (47%), Positives = 56/80 (70%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+GR+CF+ ++ EP N+ +V MS IY+ +AR +E+LR + AWK P +++IEVN
Sbjct: 4 LGRQCFDMIIQSEPQNAAAFVYMSNIYNDAHMWEDAREIEELRKAACAWKKPAKAWIEVN 63

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
++VH FVVGG HP+S EIY
Sbjct: 64 SKVHEFVVGGTNHPQSNEIY 83


>tr|B3U1U2|B3U1U2_ISOEN Pentatricopeptide repeat protein (Fragment)
OS=Isoetes engelmannii GN=PPR PE=4 SV=1
Length = 155

Score = 80.5 bits (197), Expect = 4e-14
Identities = 35/80 (43%), Positives = 56/80 (70%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+GRRCF+R++ ++ N+ Y+LMS IYS +A++LE R L WK P +++IEVN
Sbjct: 16 MGRRCFQRILHMDSYNASAYMLMSSIYSDCNMWEHAKKLEDNRQHLGVWKKPAKTWIEVN 75

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
N+VH FV+G HP++++I+
Sbjct: 76 NQVHEFVIGDRSHPQNEKIW 95


>tr|B3U1U3|B3U1U3_ISOEN Pentatricopeptide repeat protein (Fragment)
OS=Isoetes engelmannii GN=PPR PE=4 SV=1
Length = 155

Score = 77.4 bits (189), Expect = 3e-13
Identities = 38/79 (48%), Positives = 54/79 (68%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+GRRCF +VV I+P ++ YVLMS IYS G A ++++LR AWK P +++IEV+
Sbjct: 16 LGRRCFNQVVPIDPYHAGAYVLMSGIYSDSGLWEEALKIDELRQYACAWKKPAKAWIEVD 75

Query: 170 NEVHTFVVGGWGHPRSQEI 114
+VH FVVG HP+ +EI
Sbjct: 76 KKVHEFVVGEKSHPQIEEI 94


>tr|B3U1P2|B3U1P2_9MARC Pentatricopeptide repeat protein (Fragment)
OS=Lepidogyna hodgsoniae GN=PPR PE=4 SV=1
Length = 143

Score = 67.4 bits (163), Expect = 3e-10
Identities = 33/80 (41%), Positives = 50/80 (62%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+G E V+ ++P N+ GYVL+S IY+ G+ + L++ RL K PGR++IEVN
Sbjct: 4 MGEHVAELVLDLDPGNAAGYVLLSNIYAASGKWDRSADLQRQRLERGVRKQPGRTWIEVN 63

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
NEVH+F V HP+ +I+
Sbjct: 64 NEVHSFTVDDQDHPQINDIH 83


>tr|A7QPS9|A7QPS9_VITVI Chromosome chr10 scaffold_138, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00003060001
PE=4 SV=1
Length = 933

Score = 67.4 bits (163), Expect = 3e-10
Identities = 35/82 (42%), Positives = 50/82 (60%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+GRR E + +EP S +VL++ IY+ G+ N + +L K K PG S+IEV
Sbjct: 748 LGRRAAEMLFILEPEKSGTHVLLANIYASAGKWENVAEVRRLMRDSKVKKEPGMSWIEVK 807

Query: 170 NEVHTFVVGGWGHPRSQEIYVK 105
++V+TF+VG H RSQEIY K
Sbjct: 808 DKVYTFLVGDRSHYRSQEIYAK 829


>tr|A7PQD4|A7PQD4_VITVI Chromosome chr18 scaffold_24, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022022001
PE=4 SV=1
Length = 758

Score = 67.4 bits (163), Expect = 3e-10
Identities = 36/81 (44%), Positives = 46/81 (56%)
Frame = -2

Query: 347 GRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVNN 168
G+R ERV+ +EP + YVL+ IY+ G Q A + L K PG S+IEV N
Sbjct: 574 GKRVAERVIELEPEAAASYVLLYNIYNDAGIQMPATEIRNLMKDRGVKKEPGLSWIEVGN 633

Query: 167 EVHTFVVGGWGHPRSQEIYVK 105
VH+FV G HP SQ IYV+
Sbjct: 634 VVHSFVAGDRSHPNSQVIYVQ 654


>tr|A5B2K7|A5B2K7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023708 PE=4 SV=1
Length = 906

Score = 67.4 bits (163), Expect = 3e-10
Identities = 35/82 (42%), Positives = 50/82 (60%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+GRR E + +EP S +VL++ IY+ G+ N + +L K K PG S+IEV
Sbjct: 721 LGRRAAEMLFILEPEKSGTHVLLANIYASAGKWENVAEVRRLMRDSKVKKEPGMSWIEVK 780

Query: 170 NEVHTFVVGGWGHPRSQEIYVK 105
++V+TF+VG H RSQEIY K
Sbjct: 781 DKVYTFLVGDRSHYRSQEIYAK 802


>tr|B3U1N4|B3U1N4_9MARC Pentatricopeptide repeat protein (Fragment)
OS=Diplophyllum albicans GN=PPR PE=4 SV=1
Length = 143

Score = 67.0 bits (162), Expect = 4e-10
Identities = 34/80 (42%), Positives = 50/80 (62%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+G R E+++ +EP N YVL++ IY+ G+ ++ + Q RL K PGR++IEVN
Sbjct: 4 MGLRAAEQLLKLEPENVGAYVLLANIYAAAGKWDSSAAIHQDRLERCVSKQPGRAWIEVN 63

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
NEVHTF HP+ +EIY
Sbjct: 64 NEVHTFTQDDREHPQIREIY 83


>tr|Q6K2P5|Q6K2P5_ORYSJ Os09g0327200 protein OS=Oryza sativa subsp.
japonica GN=P0706E03.7 PE=4 SV=1
Length = 755

Score = 66.2 bits (160), Expect = 7e-10
Identities = 33/80 (41%), Positives = 49/80 (61%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+GR E++ +EP N+ YVL+S IY+ G+ +AR++ + KVPG S+IEV
Sbjct: 570 LGRSAAEKIFELEPENAGMYVLLSNIYASSGKWRDARKMRVMMEERGVKKVPGFSWIEVQ 629

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
N+VHTF G HP ++IY
Sbjct: 630 NKVHTFSAGDCVHPEKEKIY 649


>tr|Q1SN04|Q1SN04_MEDTR Tetratricopeptide-like helical OS=Medicago
truncatula GN=MtrDRAFT_AC139526g18v2 PE=4 SV=1
Length = 766

Score = 66.2 bits (160), Expect = 7e-10
Identities = 31/80 (38%), Positives = 46/80 (57%)
Frame = -2

Query: 350 VGRRCFERVVTIEPLNSVGYVLMSKIYSLVGEQANARRLEQLRLSLKAWKVPGRSYIEVN 171
+G + E V +EP NS YVL+S +Y+ G +A ++ + KVPG S++EV
Sbjct: 581 LGEKAAEMVFKMEPQNSGMYVLLSNLYAASGRWVDADKMRSKMRDIGVQKVPGYSWVEVQ 640

Query: 170 NEVHTFVVGGWGHPRSQEIY 111
N++HTF VG HP + IY
Sbjct: 641 NKIHTFSVGDCSHPEKERIY 660