BP914842
Clone id YMU001_000063_E03
Library
Length 549
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGAAGAATTCGCGGCCATTCTTTGCTCTGTCAATTCCCGCTTCTTAGCTGGTTCTGAT
TCCTCTACTTGGCACAACTCTTCGAACTCCTTTTCAGACAACTGGTCTCCATAAGACCTT
ACCTCTCTAGCTCTTTTGCCCCTTCCGTAGTGTTCTACATCAAGCATAGCTGCTCTCCCT
GACTTCTGCTTGTCCGAAGACCTCTCCAACTCCATAGAGTGAATAGCTGCCAAGAAAGGC
CCCATTTCATGTTCTTGCAACAGTCGTGGCGGGACTGGAAGTTGCTCCTGAATAGACTGC
ATTTCAAGTTGCTTCCTCCATTGTATCTCCTCGTCCTCAATTCTCCGTTTATCAATAGCT
TCGAATATATCAATTTCATCATCACTACGAGCCAAAAGATAATTCAGGGCATCGTCATCA
AGTACGTGAGCATCTTCTTCTTTCTTGGATTCCCTAAGGAGTGCTTCCAGGTATTCTTTT
CTATCCTCCGCACTGAACCGAGCAACTTTATCAGTATAAATAGTAGCCTTTCAAAACAAT
ACATGTATC
■■Homology search results ■■ -
sp_hit_id P51531
Definition sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens
Align length 161
Score (bit) 62.8
E-value 1.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914842|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_E03.
(531 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P51531|SMCA2_HUMAN Probable global transcription activator SN... 63 1e-09
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila mel... 60 5e-09
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces ... 58 3e-08
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Sa... 55 2e-07
sp|P51532|SMCA4_HUMAN Probable global transcription activator SN... 51 4e-06
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex sub... 49 1e-05
sp|Q4KME6|PERQ2_DANRE PERQ amino acid-rich with GYF domain-conta... 42 0.002
sp|Q07283|TRHY_HUMAN Trichohyalin OS=Homo sapiens GN=TCHH PE=1 SV=2 41 0.003
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subun... 40 0.005
sp|A5DXA0|NST1_LODEL Stress response protein NST1 OS=Lodderomyce... 37 0.045
sp|Q5JR59|K0774_HUMAN Uncharacterized protein KIAA0774 OS=Homo s... 37 0.059
sp|P42638|TPM2_SCHMA Tropomyosin-2 OS=Schistosoma mansoni PE=2 SV=1 35 0.17
sp|P45379|TNNT2_HUMAN Troponin T, cardiac muscle OS=Homo sapiens... 35 0.17
sp|Q5U236|PERQ2_XENLA PERQ amino acid-rich with GYF domain-conta... 35 0.22
sp|Q6Y7W6|PERQ2_HUMAN PERQ amino acid-rich with GYF domain-conta... 35 0.22
sp|B1AJZ9|FHAD1_HUMAN Forkhead-associated domain-containing prot... 35 0.22
sp|Q12136|SAS10_YEAST Something about silencing protein 10 OS=Sa... 35 0.29
sp|Q6Y7W8|PERQ2_MOUSE PERQ amino acid-rich with GYF domain-conta... 35 0.29
sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogast... 34 0.38
sp|O32178|FADN_BACSU Probable 3-hydroxyacyl-CoA dehydrogenase OS... 34 0.38
sp|A6W7W7|RRF_KINRD Ribosome-recycling factor OS=Kineococcus rad... 34 0.50
sp|P46504|YLX8_CAEEL Uncharacterized protein F23F12.8 OS=Caenorh... 33 0.65
sp|P37709|TRHY_RABIT Trichohyalin OS=Oryctolagus cuniculus GN=TC... 33 0.65
sp|P53352|INCE_CHICK Inner centromere protein OS=Gallus gallus G... 33 0.65
sp|Q60952|CP250_MOUSE Centrosome-associated protein CEP250 OS=Mu... 33 0.65
sp|Q5RE49|TCHP_PONAB Trichoplein keratin filament-binding protei... 33 0.85
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kin... 33 0.85
sp|Q3ULW6|CCD33_MOUSE Coiled-coil domain-containing protein 33 O... 33 0.85
sp|Q9BT92|TCHP_HUMAN Trichoplein keratin filament-binding protei... 33 1.1
sp|O88735|MAP7_MOUSE Ensconsin OS=Mus musculus GN=Map7 PE=1 SV=1 33 1.1

>sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2
OS=Homo sapiens GN=SMARCA2 PE=1 SV=2
Length = 1590

Score = 62.8 bits (151), Expect = 1e-09
Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 8/161 (4%)
Frame = -2

Query: 476 SAEDRKEYLEALLR-ESKKEEDAHVLDDDALNYLLARSDDEIDIFEAID-KRRIEDEEIQ 303
S+ +R+ +L+A+L E + EE+ V DD+ LN ++AR ++E D+F +D RR ED
Sbjct: 1209 SSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNP 1268

Query: 302 WRKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGR 123
RK PRL++E E+ P E+ER + +++ + +GR
Sbjct: 1269 KRK--------------PRLMEEDEL-PSWIIKDDAEVERLTCEEEEEKI-------FGR 1306

Query: 122 GKRAREVRSYGDQLSEKEF------EELCQVEESEPAKKRE 18
G R R Y D L+EK++ L ++EE KKR+
Sbjct: 1307 GSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRK 1347


>sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila
melanogaster GN=brm PE=1 SV=2
Length = 1638

Score = 60.5 bits (145), Expect = 5e-09
Identities = 45/162 (27%), Positives = 83/162 (51%), Gaps = 10/162 (6%)
Frame = -2

Query: 476 SAEDRKEYLEALLRE--SKKEEDAHVLDDDALNYLLARSDDEIDIFEAID-KRRIEDEEI 306
+ +R+++L+ +L + +++EE+ V DD+ +N ++ARS++EI+IF+ +D +R+ EDEEI
Sbjct: 1257 TGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEI 1316

Query: 305 QWRKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYG 126
P RL+ E E+ +L + D+ + + G
Sbjct: 1317 H--------------PGRERLIDESELPDWLT--------KDDDEVERFHYQYDEDTILG 1354

Query: 125 RGKRAREVRSYGDQLSEKEF-------EELCQVEESEPAKKR 21
RG R R+ Y D L+EKE+ E + EE + +K++
Sbjct: 1355 RGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRK 1396


>sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces
cerevisiae GN=STH1 PE=1 SV=1
Length = 1359

Score = 57.8 bits (138), Expect = 3e-08
Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 6/164 (3%)
Frame = -2

Query: 476 SAEDRKEYLEALLRE--SKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQ 303
+AE+++ +L L+ ++ ++D LDDD LN LARS DE +F+ IDK R+ E
Sbjct: 950 TAEEQEAFLRRLIESETNRDDDDKAELDDDELNDTLARSADEKILFDKIDKERMNQE--- 1006

Query: 302 WRKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGR 123
R + Q ++ PPRL+Q E L + ++E K+ D E GR
Sbjct: 1007 -RADAKAQGLRVP---PPRLIQLDE----LPKVFREDIEEHFKKE--------DSEPLGR 1050

Query: 122 GKRAREVRSYGDQLSEKEFEELCQVE----ESEPAKKRELTEQR 3
++ + V Y D L+E++F E + + E K+RE E+R
Sbjct: 1051 IRQKKRV-YYDDGLTEEQFLEAVEDDNMSLEDAIKKRREARERR 1093


>sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2
OS=Saccharomyces cerevisiae GN=SNF2 PE=1 SV=1
Length = 1703

Score = 55.1 bits (131), Expect = 2e-07
Identities = 44/160 (27%), Positives = 81/160 (50%), Gaps = 8/160 (5%)
Frame = -2

Query: 476 SAEDRKEYLEALL-----RESKKE---EDAHVLDDDALNYLLARSDDEIDIFEAIDKRRI 321
++E+++ L +LL R K+E E+ L D +N +LAR+D+E+ + +D+ R
Sbjct: 1246 TSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRS 1305

Query: 320 EDEEIQWRKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLD 141
+ E E+L V RLL++ E L I+S ++ +++S AA+
Sbjct: 1306 KKE--------------EELGVKSRLLEKSE----LPDIYSRDIGAELKREESESAAV-- 1345

Query: 140 VEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESEPAKKR 21
+ GRG R R+ +Y D +SE+++ +V + E K+
Sbjct: 1346 --YNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQ 1383


>sp|P51532|SMCA4_HUMAN Probable global transcription activator SNF2L4
OS=Homo sapiens GN=SMARCA4 PE=1 SV=2
Length = 1647

Score = 50.8 bits (120), Expect = 4e-06
Identities = 45/153 (29%), Positives = 74/153 (48%), Gaps = 7/153 (4%)
Frame = -2

Query: 440 LRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAID-KRRIEDEEIQWRKQLEMQSIQEQ 264
L E +E+ V DD+ +N ++AR ++E D+F +D RR E+ RK
Sbjct: 1285 LEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRK---------- 1334

Query: 263 LPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGRGKRAREVRSYGDQ 84
PRL++E E+ P E+ER + +++ + + +GRG R R+ Y D
Sbjct: 1335 ----PRLMEEDEL-PSWIIKDDAEVERLTCEEE-------EEKMFGRGSRHRKEVDYSDS 1382

Query: 83 LSEKEF----EE--LCQVEESEPAKKRELTEQR 3
L+EK++ EE L ++EE KK +R
Sbjct: 1383 LTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKR 1415


>sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit
snf21 OS=Schizosaccharomyces pombe GN=snf21 PE=1 SV=1
Length = 1199

Score = 48.9 bits (115), Expect = 1e-05
Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 4/154 (2%)
Frame = -2

Query: 470 EDRKEYLEALLRESKKEEDAHV---LDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQW 300
E+R+ +L +LL EE+ LDDD LN +LAR DDE+ +F+ Q
Sbjct: 897 EEREAFLRSLLENENGEEENDEKGELDDDELNEILARGDDELRLFK------------QM 944

Query: 299 RKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGRG 120
+ LE +S + RL+Q E+ F E E+++D +L E GRG
Sbjct: 945 TEDLERESPYGKNKEKERLIQVSELPEF---YQREEPEKTTD--------LLQEEPLGRG 993

Query: 119 KRAREVRSYGDQLSEKEF-EELCQVEESEPAKKR 21
R R Y + + + ++ E+ E+ P + R
Sbjct: 994 ARRRTPVVYDEAVRDAQWMAEMDMESEARPTRGR 1027


>sp|Q4KME6|PERQ2_DANRE PERQ amino acid-rich with GYF domain-containing
protein 2 OS=Danio rerio GN=gigyf2 PE=2 SV=1
Length = 1335

Score = 42.0 bits (97), Expect = 0.002
Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 8/160 (5%)
Frame = -2

Query: 458 EYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWRKQLE-M 282
E EA LR ++EE+ L++ L AR ++E ++R+E+EE+ RKQ E +
Sbjct: 775 ERREAELRAKREEEERKRLEEA----LRARQEEE--------RKRLEEEELARRKQEEAL 822

Query: 281 QSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGRGKRAREV 102
+ +EQ R +E E A+ +E R ++++ R L + ++ E+
Sbjct: 823 KRQREQEEAQRRKKEEEERLAQEEALRRLEERRREEEERRQREEFLRKQQEEERRKQEEL 882

Query: 101 RSYGDQLSEKEFEELCQV-------EESEPAKKRELTEQR 3
+ + EK EE ++ E +KRE QR
Sbjct: 883 EAQRRREEEKRLEEEAAAAAAALLRQQQEEQEKREQEAQR 922


>sp|Q07283|TRHY_HUMAN Trichohyalin OS=Homo sapiens GN=TCHH PE=1 SV=2
Length = 1943

Score = 41.2 bits (95), Expect = 0.003
Identities = 39/158 (24%), Positives = 75/158 (47%), Gaps = 3/158 (1%)
Frame = -2

Query: 470 EDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWRKQ 291
E+ ++ E LLRE +++ + + ++E + E +KRR+++ E Q+R++
Sbjct: 994 EELQQEEEQLLREEREKRRRQEWERQYRKKDELQQEEEQLLREEREKRRLQERERQYREE 1053

Query: 290 LEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQ---KSGRAAMLDVEHYGRG 120
E+Q +EQL +G ELER K+ + +L E R
Sbjct: 1054 EELQQEEEQL-----------LGEERETRRRQELERQYRKEEELQQEEEQLLREEPEKRR 1102

Query: 119 KRAREVRSYGDQLSEKEFEELCQVEESEPAKKRELTEQ 6
++ RE + ++ ++E E+L + EE E +++EL Q
Sbjct: 1103 RQERERQCREEEELQQEEEQLLR-EEREKRRRQELERQ 1139



Score = 39.3 bits (90), Expect = 0.012
Identities = 41/173 (23%), Positives = 80/173 (46%), Gaps = 14/173 (8%)
Frame = -2

Query: 482 RFSAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKR--RIEDEE 309
RF DR+ E R +K ++ LA +++ + E +++R + DEE
Sbjct: 121 RFEPRDRQLEEEPGQRRRQKRQEQE--------RELAEGEEQSEKQERLEQRDRQRRDEE 172

Query: 308 IQWRKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHY 129
+ WR++ E Q +E R +E + L + E E D+++ R +L++
Sbjct: 173 L-WRQRQEWQEREE------RRAEEEQ----LQSCKGHETEEFPDEEQLRRRELLELRRK 221

Query: 128 GRGKRAREVRSYGDQLSEKEFE------------ELCQVEESEPAKKRELTEQ 6
GR ++ ++ R D++ ++E E E +++E EP ++REL E+
Sbjct: 222 GREEKQQQRRERQDRVFQEEEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEE 274



Score = 34.3 bits (77), Expect = 0.38
Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 3/148 (2%)
Frame = -2

Query: 470 EDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWRKQ 291
E+ ++ E LLRE +++ L+ + ++E + E +KRR ++ E Q+R++
Sbjct: 1114 EELQQEEEQLLREEREKRRRQELERQYREEEEVQQEEEQLLREEPEKRRRQELERQYREE 1173

Query: 290 LEMQSIQEQL--PVPPRLLQEHEMGPFLAAIHSMELERSSDKQK-SGRAAMLDVEHYGRG 120
E+Q +EQL + QE E EL+R KQ+ D++
Sbjct: 1174 EELQQEEEQLLREEQEKRRQERER----QYREEEELQRQKRKQRYRDEDQRSDLKWQWEP 1229

Query: 119 KRAREVRSYGDQLSEKEFEELCQVEESE 36
++ VR +E E+ Q+E+S+
Sbjct: 1230 EKENAVRDNKVYCKGRENEQFRQLEDSQ 1257



Score = 31.6 bits (70), Expect = 2.5
Identities = 40/179 (22%), Positives = 77/179 (43%), Gaps = 24/179 (13%)
Frame = -2

Query: 470 EDRKEYLEALLRESKK--EEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
++ +E L+ RE ++ E++ +++ L + ++E + E +KRR ++ E Q+R
Sbjct: 907 QEEEEELQREEREKRRRQEQERQYREEEQL-----QQEEEQLLREEREKRRRQERERQYR 961

Query: 296 KQLEMQSIQEQL-----------PVPPRLLQEHEMGPFLAAIHSMELE-----------R 183
K ++Q +EQL + +E E+ + E E R
Sbjct: 962 KDKKLQQKEEQLLGEEPEKRRRQEREKKYREEEELQQEEEQLLREEREKRRRQEWERQYR 1021

Query: 182 SSDKQKSGRAAMLDVEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESEPAKKRELTEQ 6
D+ + +L E R + RE R Y ++ ++ EE EE E +++EL Q
Sbjct: 1022 KKDELQQEEEQLLREEREKRRLQERE-RQYREEEELQQEEEQLLGEERETRRRQELERQ 1079



Score = 30.0 bits (66), Expect = 7.2
Identities = 28/130 (21%), Positives = 58/130 (44%), Gaps = 4/130 (3%)
Frame = -2

Query: 380 LLARSDDEIDIFEAIDKRRIEDEEIQWRKQLEMQSI----QEQLPVPPRLLQEHEMGPFL 213
+L + ++++ E +R +++EE Q RK LE Q + QE+ RL +E ++
Sbjct: 252 VLRKEEEKLQEEEPQRQRELQEEEEQLRK-LERQELRRERQEEEQQQQRLRREQQL---- 306

Query: 212 AAIHSMELERSSDKQKSGRAAMLDVEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESEP 33
+ E +Q+ R + +R +++R ++ E++ + E E
Sbjct: 307 ----RRKQEEERREQQEERREQQERREQQEERREQQLRREQEERREQQLRREQEEERREQ 362

Query: 32 AKKRELTEQR 3
+RE E+R
Sbjct: 363 QLRREQEEER 372


>sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit
snf22 OS=Schizosaccharomyces pombe GN=snf22 PE=1 SV=2
Length = 1680

Score = 40.4 bits (93), Expect = 0.005
Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 5/148 (3%)
Frame = -2

Query: 470 EDRKEYLEALLRESKKEEDAHV----LDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQ 303
E+R+ +L +LL E ++D + L DD LN L++R+D+E+ +F+ +DK R +
Sbjct: 1348 EEREAFLRSLL-EHDGDDDHDLTYGELQDDELNELISRTDEELVLFKKLDKERAATDIYG 1406

Query: 302 WRKQLEMQSIQEQLPVPPRLLQEHEMGPFL-AAIHSMELERSSDKQKSGRAAMLDVEHYG 126
K LE RLL +E+ F + S ++ SS+ L+ ++
Sbjct: 1407 KGKPLE------------RLLTVNELPDFYKVEVDSFAVQSSSE---------LEDQYLE 1445

Query: 125 RGKRAREVRSYGDQLSEKEFEELCQVEE 42
R +R R SY +E +EL V++
Sbjct: 1446 RKRRRRNSISY----TELTLDELNTVDD 1469


>sp|A5DXA0|NST1_LODEL Stress response protein NST1 OS=Lodderomyces
elongisporus GN=NST1 PE=3 SV=1
Length = 1637

Score = 37.4 bits (85), Expect = 0.045
Identities = 39/158 (24%), Positives = 68/158 (43%), Gaps = 2/158 (1%)
Frame = -2

Query: 470 EDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDE--IDIFEAIDKRRIEDEEIQWR 297
ED +EY E + EED +D+ L ++ DE +D E D + D E +
Sbjct: 762 EDDEEYEYGDDEEEEDEEDEEEGEDEELEEVVEDDVDEEILDDEEEFDAKNASDTESEIS 821

Query: 296 KQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGRGK 117
++ +MQ I+ RL + F + S E+ S + + R ++E K
Sbjct: 822 EEEKMQEIR-------RLFLIQVIKLFQERLKSAYKEKVS--KDNTRKLFEELEAEEAAK 872

Query: 116 RAREVRSYGDQLSEKEFEELCQVEESEPAKKRELTEQR 3
R +E + + KE + L Q+ + E +K+E +R
Sbjct: 873 REKEAKKLKQKEKAKERKRLQQLAKEEEKRKKEEEAKR 910


tr_hit_id A9TXL2
Definition tr|A9TXL2|A9TXL2_PHYPA SWI/SNF class chromatin remodeling complex protein OS=Physcomitrella patens subsp. patens
Align length 164
Score (bit) 152.0
E-value 1.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914842|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_E03.
(531 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TXL2|A9TXL2_PHYPA SWI/SNF class chromatin remodeling comple... 152 1e-35
tr|A7NW95|A7NW95_VITVI Chromosome chr5 scaffold_2, whole genome ... 145 1e-33
tr|Q656N0|Q656N0_ORYSJ Putative STH1 protein OS=Oryza sativa sub... 143 5e-33
tr|B8B0A6|B8B0A6_ORYSI Putative uncharacterized protein OS=Oryza... 143 5e-33
tr|Q9SL27|Q9SL27_ARATH Putative SNF2 subfamily transcription reg... 135 1e-30
tr|Q9AUB4|Q9AUB4_ARATH Putative chromatin remodeling protein SYD... 135 1e-30
tr|Q5BN47|Q5BN47_ARATH SPLAYED splice variant OS=Arabidopsis tha... 135 1e-30
tr|A3BAD0|A3BAD0_ORYSJ Putative uncharacterized protein OS=Oryza... 124 4e-27
tr|Q5QE81|Q5QE81_ORYSJ SYD chromatin remodeling ATPase (Fragment... 120 3e-26
tr|A8Q0N3|A8Q0N3_MALGO Putative uncharacterized protein OS=Malas... 76 1e-12
tr|B7PZI4|B7PZI4_IXOSC Smarca4, putative (Fragment) OS=Ixodes sc... 68 3e-10
tr|A8X136|A8X136_CAEBR Putative uncharacterized protein OS=Caeno... 67 7e-10
tr|Q19106|Q19106_CAEEL Protein F01G4.1, confirmed by transcript ... 66 1e-09
tr|Q5MMR9|Q5MMR9_XENLA Brg1 OS=Xenopus laevis PE=2 SV=1 65 3e-09
tr|Q4VQ79|Q4VQ79_XENLA Brg1 OS=Xenopus laevis GN=Brg1 PE=2 SV=1 65 3e-09
tr|Q5K9G4|Q5K9G4_CRYNE Putative uncharacterized protein OS=Crypt... 63 8e-09
tr|Q55K35|Q55K35_CRYNE Putative uncharacterized protein OS=Crypt... 63 8e-09
tr|Q90755|Q90755_CHICK BRM protein OS=Gallus gallus GN=brm PE=2 ... 63 1e-08
tr|Q8R1W7|Q8R1W7_MOUSE Smarca2 protein (Fragment) OS=Mus musculu... 63 1e-08
tr|Q7TND4|Q7TND4_MOUSE Smarca2 protein (Fragment) OS=Mus musculu... 63 1e-08
tr|Q6DUH4|Q6DUH4_RAT SWI/SNF-related matrix-associated actin-dep... 63 1e-08
tr|Q6DIC0|Q6DIC0_MOUSE Smarca2 protein OS=Mus musculus GN=Smarca... 63 1e-08
tr|Q3UX55|Q3UX55_MOUSE Putative uncharacterized protein (Fragmen... 63 1e-08
tr|Q3UHL2|Q3UHL2_MOUSE Putative uncharacterized protein OS=Mus m... 63 1e-08
tr|A5PKK5|A5PKK5_BOVIN SMARCA2 protein OS=Bos taurus GN=SMARCA2 ... 63 1e-08
tr|B4DK35|B4DK35_HUMAN cDNA FLJ61591, highly similar to Probable... 63 1e-08
tr|Q4RV11|Q4RV11_TETNG Chromosome 12 SCAF14993, whole genome sho... 62 1e-08
tr|B4DSC8|B4DSC8_HUMAN cDNA FLJ53181, highly similar to Probable... 62 2e-08
tr|B4J3P1|B4J3P1_DROGR GH16759 OS=Drosophila grimshawi GN=GH1675... 62 2e-08
tr|A8X678|A8X678_CAEBR Putative uncharacterized protein OS=Caeno... 61 3e-08

>tr|A9TXL2|A9TXL2_PHYPA SWI/SNF class chromatin remodeling complex
protein OS=Physcomitrella patens subsp. patens GN=CHR1522
PE=4 SV=1
Length = 2174

Score = 152 bits (384), Expect = 1e-35
Identities = 81/164 (49%), Positives = 113/164 (68%), Gaps = 18/164 (10%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEI--- 306
SAEDR+EYLE+LLRE KKEE A VLDD+ALN LLARSD EIDIFEA+DK+R ++E+I
Sbjct: 1963 SAEDRREYLESLLREPKKEEVALVLDDEALNDLLARSDAEIDIFEAVDKQRAQEEQIAFL 2022

Query: 305 --------------QWRKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAI-HSMELERSSDK 171
+W++ ++++ E P+PPRL+ E E+GP + + + + + S K
Sbjct: 2023 DQDVLTTKSMPVYARWKQCVKVKLGCEPPPLPPRLIGESELGPIVKVLTNKLTKKPGSSK 2082

Query: 170 QKSGRAAMLDVEHYGRGKRAREVRSYGDQLSEKEFEELCQVEES 39
S + +++ YGRGKRARE+RSYG+Q SE+EFE+LCQV+ S
Sbjct: 2083 GGSSKGGAAEIQDYGRGKRAREIRSYGEQFSEREFEKLCQVDNS 2126


>tr|A7NW95|A7NW95_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019834001
PE=4 SV=1
Length = 1491

Score = 145 bits (366), Expect = 1e-33
Identities = 85/163 (52%), Positives = 108/163 (66%), Gaps = 7/163 (4%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
SAEDR+EYLE+LLRESKKEE VLDDDALN LLARS+ EIDIFE+IDK+R E E W+
Sbjct: 1249 SAEDRREYLESLLRESKKEEAMPVLDDDALNDLLARSESEIDIFESIDKKRQEAEMATWK 1308

Query: 296 KQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSME------LERSSDKQKSGRAAMLDVE 135
K L Q ++ P+P RL+ + ++ F A+ E + K+K LD +
Sbjct: 1309 K-LVGQGMELAPPLPSRLVTDDDLKVFYQAMKIYEESNAGVISNVGVKRKGEYLGGLDTQ 1367

Query: 134 HYGRGKRAREVRSYGDQLSEKEFEELCQVEESE-PAKKRELTE 9
YGRGKRAREVRSY +Q +E+EFE+LCQV+ E P K E+ E
Sbjct: 1368 QYGRGKRAREVRSYEEQWTEEEFEKLCQVDSPESPKLKEEMVE 1410


>tr|Q656N0|Q656N0_ORYSJ Putative STH1 protein OS=Oryza sativa subsp.
japonica GN=P0592E11.17-1 PE=4 SV=1
Length = 3389

Score = 143 bits (361), Expect = 5e-33
Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 8/155 (5%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
SAEDR+EYLE+LLR KKEE A VLDDDALN LLARS+DEIDIFE+IDK+R E+E W
Sbjct: 1494 SAEDRREYLESLLRGGKKEEAAPVLDDDALNDLLARSEDEIDIFESIDKQRREEEMATWL 1553

Query: 296 KQLEMQSIQEQLP--VPPRLLQEHEMGPFLAAIHSMELERSSD------KQKSGRAAMLD 141
++ S P +P RL+ + ++ F H+M++ SS+ ++ G LD
Sbjct: 1554 TVVQNSSTSGLDPSVMPSRLVTDDDLKSF---CHAMKIYESSNIKSVKVVRRKGELGGLD 1610

Query: 140 VEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESE 36
+HYGRGKRAREVRSY DQ +E+EFE+LCQV+ +
Sbjct: 1611 TQHYGRGKRAREVRSYEDQWTEEEFEKLCQVDSPD 1645


>tr|B8B0A6|B8B0A6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_22408 PE=4 SV=1
Length = 4284

Score = 143 bits (361), Expect = 5e-33
Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 8/155 (5%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
SAEDR+EYLE+LLR KKEE A VLDDDALN LLARS+DEIDIFE+IDK+R E+E W
Sbjct: 1464 SAEDRREYLESLLRGGKKEEAAPVLDDDALNDLLARSEDEIDIFESIDKQRREEEMATWL 1523

Query: 296 KQLEMQSIQEQLP--VPPRLLQEHEMGPFLAAIHSMELERSSD------KQKSGRAAMLD 141
++ S P +P RL+ + ++ F H+M++ SS+ ++ G LD
Sbjct: 1524 TVVQNSSTSGLDPSVMPSRLVTDDDLKSF---CHAMKIYESSNIKSVKVVRRKGELGGLD 1580

Query: 140 VEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESE 36
+HYGRGKRAREVRSY DQ +E+EFE+LCQV+ +
Sbjct: 1581 TQHYGRGKRAREVRSYEDQWTEEEFEKLCQVDSPD 1615


>tr|Q9SL27|Q9SL27_ARATH Putative SNF2 subfamily transcription
regulator OS=Arabidopsis thaliana GN=At2g28290 PE=2 SV=2
Length = 3571

Score = 135 bits (341), Expect = 1e-30
Identities = 81/167 (48%), Positives = 105/167 (62%), Gaps = 10/167 (5%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
SAEDRKEYLE+LLRESKKEEDA VLDDDALN L+AR + EIDIFE+IDK+R E+E W
Sbjct: 1229 SAEDRKEYLESLLRESKKEEDAPVLDDDALNDLIARRESEIDIFESIDKQRKENEMETWN 1288

Query: 296 KQLE---MQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSD------KQKSGRAAML 144
+ S +P RL+ E ++ + ++ + K+K G L
Sbjct: 1289 TLVHGPGSDSFAHIPSIPSRLVTEDDLKLLYETMKLNDVPMVAKESTVGMKRKDGSMGGL 1348

Query: 143 DVEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESE-PAKKRELTEQ 6
D YGRGKRAREVRSY ++L+E+EFE+LCQ E + P K E +E+
Sbjct: 1349 DTHQYGRGKRAREVRSYEEKLTEEEFEKLCQTESPDSPQGKGEGSER 1395


>tr|Q9AUB4|Q9AUB4_ARATH Putative chromatin remodeling protein SYD
OS=Arabidopsis thaliana GN=SPLAYED PE=2 SV=1
Length = 3574

Score = 135 bits (341), Expect = 1e-30
Identities = 81/167 (48%), Positives = 105/167 (62%), Gaps = 10/167 (5%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
SAEDRKEYLE+LLRESKKEEDA VLDDDALN L+AR + EIDIFE+IDK+R E+E W
Sbjct: 1232 SAEDRKEYLESLLRESKKEEDAPVLDDDALNDLIARRESEIDIFESIDKQRKENEMETWN 1291

Query: 296 KQLE---MQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSD------KQKSGRAAML 144
+ S +P RL+ E ++ + ++ + K+K G L
Sbjct: 1292 TLVHGPGSDSFAHIPSIPSRLVTEDDLKLLYETMKLNDVPMVAKESTVGMKRKDGSMGGL 1351

Query: 143 DVEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESE-PAKKRELTEQ 6
D YGRGKRAREVRSY ++L+E+EFE+LCQ E + P K E +E+
Sbjct: 1352 DTHQYGRGKRAREVRSYEEKLTEEEFEKLCQTESPDSPQGKGEGSER 1398


>tr|Q5BN47|Q5BN47_ARATH SPLAYED splice variant OS=Arabidopsis thaliana
PE=2 SV=1
Length = 3543

Score = 135 bits (341), Expect = 1e-30
Identities = 81/167 (48%), Positives = 105/167 (62%), Gaps = 10/167 (5%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
SAEDRKEYLE+LLRESKKEEDA VLDDDALN L+AR + EIDIFE+IDK+R E+E W
Sbjct: 1232 SAEDRKEYLESLLRESKKEEDAPVLDDDALNDLIARRESEIDIFESIDKQRKENEMETWN 1291

Query: 296 KQLE---MQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSD------KQKSGRAAML 144
+ S +P RL+ E ++ + ++ + K+K G L
Sbjct: 1292 TLVHGPGSDSFAHIPSIPSRLVTEDDLKLLYETMKLNDVPMVAKESTVGMKRKDGSMGGL 1351

Query: 143 DVEHYGRGKRAREVRSYGDQLSEKEFEELCQVEESE-PAKKRELTEQ 6
D YGRGKRAREVRSY ++L+E+EFE+LCQ E + P K E +E+
Sbjct: 1352 DTHQYGRGKRAREVRSYEEKLTEEEFEKLCQTESPDSPQGKGEGSER 1398


>tr|A3BAD0|A3BAD0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_020002 PE=4 SV=1
Length = 4247

Score = 124 bits (310), Expect = 4e-27
Identities = 72/147 (48%), Positives = 88/147 (59%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWR 297
SAEDR+EYLE+LLR KKEE A VLDDDALN LLARS+DEIDIFE+IDK+R E+E I
Sbjct: 1432 SAEDRREYLESLLRGGKKEEAAPVLDDDALNDLLARSEDEIDIFESIDKQRREEEMIY-- 1489

Query: 296 KQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGRGK 117
S ++ ++ G LD +HYGRGK
Sbjct: 1490 -------------------------------ESSNIKSVKVVRRKGELGGLDTQHYGRGK 1518

Query: 116 RAREVRSYGDQLSEKEFEELCQVEESE 36
RAREVRSY DQ +E+EFE+LCQV+ +
Sbjct: 1519 RAREVRSYEDQWTEEEFEKLCQVDSPD 1545


>tr|Q5QE81|Q5QE81_ORYSJ SYD chromatin remodeling ATPase (Fragment)
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 2698

Score = 120 bits (302), Expect = 3e-26
Identities = 69/139 (49%), Positives = 92/139 (66%), Gaps = 8/139 (5%)
Frame = -2

Query: 428 KKEEDAHVLDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQWRKQLEMQSIQEQLP--V 255
KKEE A VLDDDALN LLARS+DEIDIFE+IDK+R E+E W ++ S P +
Sbjct: 2 KKEEAAPVLDDDALNDLLARSEDEIDIFESIDKQRREEEMATWLTVVQNSSTSGLDPSVM 61

Query: 254 PPRLLQEHEMGPFLAAIHSMELERSSD------KQKSGRAAMLDVEHYGRGKRAREVRSY 93
P RL+ + ++ F H+M++ SS+ ++ G LD +HYGRGKRAREVRSY
Sbjct: 62 PSRLVTDDDLKSF---CHAMKIYESSNIKSVKVVRRKGELGGLDTQHYGRGKRAREVRSY 118

Query: 92 GDQLSEKEFEELCQVEESE 36
DQ +E+EFE+LCQV+ +
Sbjct: 119 EDQWTEEEFEKLCQVDSPD 137


>tr|A8Q0N3|A8Q0N3_MALGO Putative uncharacterized protein
OS=Malassezia globosa (strain ATCC 96807 / CBS 7966)
GN=MGL_2058 PE=4 SV=1
Length = 526

Score = 75.9 bits (185), Expect = 1e-12
Identities = 55/163 (33%), Positives = 84/163 (51%), Gaps = 5/163 (3%)
Frame = -2

Query: 476 SAEDRKEYLEALLRESKKEEDAHV--LDDDALNYLLARSDDEIDIFEAIDKRRIEDEEIQ 303
+A++R+ L A+L +EE+ L+DD LN LLARSD+E+ F+ +D+ RI DEE +
Sbjct: 131 TADERELLLRAMLEADNEEEEEEQGELNDDELNELLARSDEEVAKFQQVDRERIADEETE 190

Query: 302 WRKQLEMQSIQEQLPVPPRLLQEHEMGPFLAAIHSMELERSSDKQKSGRAAMLDVEHYGR 123
WR ++ P+P RL+QEHE L AI+ + + + +E
Sbjct: 191 WR------ALGHTGPMPDRLIQEHE----LPAIYQRDFDTD---------VIDGIEEEQP 231

Query: 122 GKRAREVRSYGDQLSEKEFEELCQVEE---SEPAKKRELTEQR 3
R R V Y D L+E++F + EE +KRE E+R
Sbjct: 232 LTRRRNVVRYDDGLTEEQFLRALEDEEDLNEVVERKRERAEKR 274