BP914848
Clone id YMU001_000063_E09
Library
Length 587
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_E09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGAACACGAATGGTCATTGGAATCAGGCTATTCATGGCATGACTATGAATGCAAGAAAGT
TGTTTTTAGAAACGGATCAAGAGCTATTTCAAGAGTGTAAGCGTAAATTTAAAGAAGAGG
AGGCAAATGCAGTCGTCCTTAAAGAGAAGCAAAACCTGATGTGGCAGCAGCTAGAAGTGG
CGGCTGCATCAAGAGTCGGTAGGAAGTGAAATACAATGAAATGGCAAGATTATGAAAAGG
GATAAAGTGGCTTAATCTGAATTTCCTGGAGAGGTCTACGTCTTCTTCAACAAAGTTTTT
TAGGACTCTCACTCTCAGGTTAGACTTCAATTCTTTGCAAGGCAAACCATCATCAGAAAT
GGCGCTGAAGAGTCTTATCGCCTTTTACTGTCATGAAGAGAAGATATTGCAGCAGCAATC
TGGTCTTCTTGGTGCAGATGACCAAATGTATTCTCCTGTCAACCTTCTTGCCATCTATTC
TCTTTGAAGGTTACTAGATTCAATATTTAGTAGCGGTGGTTTGACCCTTACGCCTTGTAA
TTGTGCAGAACAAATGTCATCTTTGTTACCTTCAAGAGAGCTGTCTG
■■Homology search results ■■ -
sp_hit_id Q9SV41
Definition sp|Q9SV41|2A5E_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' epsilon isoform OS=Arabidopsis thaliana
Align length 62
Score (bit) 77.4
E-value 5.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914848|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_E09.
(587 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SV41|2A5E_ARATH Serine/threonine protein phosphatase 2A 57 ... 77 5e-14
sp|O04376|2A5B_ARATH Serine/threonine protein phosphatase 2A 57 ... 76 1e-13
sp|Q8RW96|2A5G_ARATH Serine/threonine protein phosphatase 2A 59 ... 74 4e-13
sp|Q9LVE2|2A5Z_ARATH Serine/threonine protein phosphatase 2A 59 ... 72 2e-12
sp|Q9LU89|2A5N_ARATH Serine/threonine protein phosphatase 2A 59 ... 69 1e-11
sp|O04375|2A5A_ARATH Serine/threonine protein phosphatase 2A 57 ... 67 5e-11
sp|Q8LF36|2A5T_ARATH Serine/threonine protein phosphatase 2A 57 ... 65 2e-10
sp|Q93YV6|2A5I_ARATH Serine/threonine protein phosphatase 2A 57 ... 65 3e-10
sp|Q28653|2A5D_RABIT Serine/threonine-protein phosphatase 2A 56 ... 60 8e-09
sp|Q14738|2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 60 8e-09
sp|Q9ZQY6|2A5D_ARATH Serine/threonine protein phosphatase 2A 55 ... 60 1e-08
sp|Q28651|2A5G_RABIT Serine/threonine-protein phosphatase 2A 56 ... 56 2e-07
sp|Q60996|2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 ... 56 2e-07
sp|Q13362|2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 56 2e-07
sp|P38903|2A5D_YEAST Serine/threonine-protein phosphatase 2A 56 ... 43 0.001
sp|Q15173|2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 40 0.011
sp|Q28647|2A5B_RABIT Serine/threonine-protein phosphatase 2A 56 ... 39 0.019
sp|Q10428|2AD1_SCHPO Serine/threonine-protein phosphatase 2A 56 ... 39 0.025
sp|Q61151|2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 ... 38 0.043
sp|Q16537|2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 38 0.043
sp|P78759|2AD2_SCHPO Serine/threonine-protein phosphatase 2A 56 ... 36 0.16
sp|A8H1T4|MUTS_SHEPA DNA mismatch repair protein mutS OS=Shewane... 30 8.9
sp|B0TK13|MUTS_SHEHH DNA mismatch repair protein mutS OS=Shewane... 30 8.9
sp|Q54LH5|INT4_DICDI Integrator complex subunit 4 homolog OS=Dic... 30 8.9

>sp|Q9SV41|2A5E_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' epsilon isoform OS=Arabidopsis
thaliana GN=B'EPSILON PE=2 SV=1
Length = 497

Score = 77.4 bits (189), Expect = 5e-14
Identities = 32/62 (51%), Positives = 47/62 (75%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N GHWNQA+HG++ N R++FLE D ELF+EC++++ E EA A L E++ L W++LE A
Sbjct: 432 NMKGHWNQAVHGLSENVRRMFLEMDTELFEECEKQYLENEAKACELLEQRELTWKRLEEA 491

Query: 183 AA 188
A+
Sbjct: 492 AS 493


>sp|O04376|2A5B_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' beta isoform OS=Arabidopsis
thaliana GN=B'BETA PE=1 SV=1
Length = 499

Score = 75.9 bits (185), Expect = 1e-13
Identities = 30/66 (45%), Positives = 49/66 (74%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N HWNQA+HG+T N +K+F+E D ELF+EC+R+++E++A + ++E++ W++L A
Sbjct: 423 NIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKEVEEQRQYTWKRLAEA 482

Query: 183 AASRVG 200
AA R G
Sbjct: 483 AAERDG 488


>sp|Q8RW96|2A5G_ARATH Serine/threonine protein phosphatase 2A 59 kDa
regulatory subunit B' gamma isoform OS=Arabidopsis
thaliana GN=B'GAMMA PE=1 SV=2
Length = 522

Score = 74.3 bits (181), Expect = 4e-13
Identities = 33/64 (51%), Positives = 43/64 (67%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT GHWNQA+ +T+N RK+ ETDQ LF EC KF+E+EAN + K+ W+ LE
Sbjct: 433 NTRGHWNQAVQSLTLNVRKVMAETDQILFDECLAKFQEDEANETEVVAKREATWKLLEEL 492

Query: 183 AASR 194
AAS+
Sbjct: 493 AASK 496


>sp|Q9LVE2|2A5Z_ARATH Serine/threonine protein phosphatase 2A 59 kDa
regulatory subunit B' zeta isoform OS=Arabidopsis
thaliana GN=B'ZETA PE=2 SV=2
Length = 546

Score = 72.0 bits (175), Expect = 2e-12
Identities = 32/64 (50%), Positives = 41/64 (64%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT GHWNQA+ +T+N RK+ E DQ LF EC KF+ EE N +K K+ WQ+LE
Sbjct: 454 NTRGHWNQAVQSLTINVRKVLCEIDQVLFDECLAKFQVEEVNKTEVKAKRERTWQRLEDL 513

Query: 183 AASR 194
A S+
Sbjct: 514 ATSK 517


>sp|Q9LU89|2A5N_ARATH Serine/threonine protein phosphatase 2A 59 kDa
regulatory subunit B' eta isoform OS=Arabidopsis
thaliana GN=B'ETA PE=2 SV=1
Length = 510

Score = 69.3 bits (168), Expect = 1e-11
Identities = 28/58 (48%), Positives = 40/58 (68%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLE 176
N HWNQA+H +T+N RK+F + D ELF+EC KFKE+E+ A + K+ W++LE
Sbjct: 445 NAQKHWNQAVHSLTLNVRKIFHDLDPELFKECLAKFKEDESKAAETEAKREATWKRLE 502


>sp|O04375|2A5A_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' alpha isoform OS=Arabidopsis
thaliana GN=B'ALPHA PE=1 SV=1
Length = 495

Score = 67.4 bits (163), Expect = 5e-11
Identities = 24/64 (37%), Positives = 47/64 (73%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N HWNQA+HG++ N +++F+E D ELF+EC+++++E++A + ++E++ W++L+ A
Sbjct: 423 NIESHWNQAVHGLSANIKRMFMEMDPELFEECQQQYEEKQAKSKQVEEQRQNRWRRLDEA 482

Query: 183 AASR 194
R
Sbjct: 483 VEER 486


>sp|Q8LF36|2A5T_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' theta isoform OS=Arabidopsis
thaliana GN=B'THETA PE=2 SV=2
Length = 492

Score = 65.5 bits (158), Expect = 2e-10
Identities = 25/58 (43%), Positives = 40/58 (68%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLE 176
NT HWNQA+H +T+N +K+F + D ELF++C KF+E+E+ + K+ W++LE
Sbjct: 424 NTQKHWNQAVHSLTLNVQKIFNDIDAELFKDCLAKFREDESKEAEIGAKREATWKRLE 481


>sp|Q93YV6|2A5I_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' iota isoform OS=Arabidopsis
thaliana GN=B'IOTA PE=2 SV=1
Length = 500

Score = 64.7 bits (156), Expect = 3e-10
Identities = 27/64 (42%), Positives = 40/64 (62%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N HWNQ++ +T+N RK+F E D+ LF C +FKE+EA EK+ +W +LE A
Sbjct: 418 NAQNHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFKEDEAKQCSAAEKRKEVWARLENA 477

Query: 183 AASR 194
A+ +
Sbjct: 478 ASMK 481


>sp|Q28653|2A5D_RABIT Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit delta isoform OS=Oryctolagus
cuniculus GN=PPP2R5D PE=2 SV=1
Length = 586

Score = 60.1 bits (144), Expect = 8e-09
Identities = 24/61 (39%), Positives = 40/61 (65%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N+ HWN+ IHG+ NA KLF+E +Q+LF +C +++K E+ +++ MWQ++E
Sbjct: 437 NSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEEL 496

Query: 183 A 185
A
Sbjct: 497 A 497


>sp|Q14738|2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit delta isoform OS=Homo sapiens
GN=PPP2R5D PE=1 SV=1
Length = 602

Score = 60.1 bits (144), Expect = 8e-09
Identities = 24/61 (39%), Positives = 40/61 (65%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N+ HWN+ IHG+ NA KLF+E +Q+LF +C +++K E+ +++ MWQ++E
Sbjct: 453 NSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEEL 512

Query: 183 A 185
A
Sbjct: 513 A 513


tr_hit_id A9RXL8
Definition tr|A9RXL8|A9RXL8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 64
Score (bit) 87.0
E-value 7.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914848|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_E09.
(587 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RXL8|A9RXL8_PHYPA Predicted protein OS=Physcomitrella paten... 87 7e-16
tr|A9T630|A9T630_PHYPA Predicted protein OS=Physcomitrella paten... 86 2e-15
tr|A9SNL8|A9SNL8_PHYPA Predicted protein OS=Physcomitrella paten... 85 3e-15
tr|A9SNL3|A9SNL3_PHYPA Predicted protein OS=Physcomitrella paten... 85 3e-15
tr|A7PHZ0|A7PHZ0_VITVI Chromosome chr13 scaffold_17, whole genom... 83 1e-14
tr|A5BY29|A5BY29_VITVI Putative uncharacterized protein OS=Vitis... 83 1e-14
tr|A9TVY5|A9TVY5_PHYPA Predicted protein OS=Physcomitrella paten... 81 5e-14
tr|A9SJF2|A9SJF2_PHYPA Predicted protein OS=Physcomitrella paten... 80 1e-13
tr|B6SWX8|B6SWX8_MAIZE Transposon protein OS=Zea mays PE=2 SV=1 77 5e-13
tr|Q9AYE5|Q9AYE5_ORYSJ Putative B' regulatory subunit of protein... 77 9e-13
tr|Q7Y011|Q7Y011_ORYSJ Os03g0681800 protein OS=Oryza sativa subs... 77 9e-13
tr|B8APJ1|B8APJ1_ORYSI Putative uncharacterized protein OS=Oryza... 77 9e-13
tr|A5BED9|A5BED9_VITVI Putative uncharacterized protein (Chromos... 77 9e-13
tr|A3ALG2|A3ALG2_ORYSJ Putative uncharacterized protein OS=Oryza... 77 9e-13
tr|B6SGQ1|B6SGQ1_MAIZE Transposon protein OS=Zea mays PE=2 SV=1 76 2e-12
tr|A9PGQ5|A9PGQ5_POPTR Putative uncharacterized protein OS=Popul... 75 2e-12
tr|B7ZXD0|B7ZXD0_MAIZE Putative uncharacterized protein OS=Zea m... 75 3e-12
tr|Q0WNY8|Q0WNY8_ARATH Phosphatase like protein OS=Arabidopsis t... 74 5e-12
tr|A7QBU1|A7QBU1_VITVI Chromosome chr1 scaffold_75, whole genome... 74 5e-12
tr|A5BUF9|A5BUF9_VITVI Putative uncharacterized protein OS=Vitis... 74 5e-12
tr|A9SI97|A9SI97_PHYPA Predicted protein OS=Physcomitrella paten... 72 2e-11
tr|B7ZZN9|B7ZZN9_MAIZE Putative uncharacterized protein OS=Zea m... 72 2e-11
tr|A8HS05|A8HS05_CHLRE PP2A-widerborst subunit OS=Chlamydomonas ... 72 3e-11
tr|Q8L6I5|Q8L6I5_ORYSA Putative uncharacterized protein B'teta O... 71 4e-11
tr|Q6YX33|Q6YX33_ORYSJ Os08g0122000 protein OS=Oryza sativa subs... 71 4e-11
tr|B8BAE1|B8BAE1_ORYSI Putative uncharacterized protein OS=Oryza... 71 4e-11
tr|A3BP63|A3BP63_ORYSJ Putative uncharacterized protein OS=Oryza... 71 4e-11
tr|B4FXJ3|B4FXJ3_MAIZE Putative uncharacterized protein OS=Zea m... 70 9e-11
tr|Q8L6I6|Q8L6I6_ORYSA Putative uncharacterized protein B'zeta O... 69 1e-10
tr|Q75LC7|Q75LC7_ORYSJ Os03g0844500 protein OS=Oryza sativa subs... 69 1e-10

>tr|A9RXL8|A9RXL8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_179181 PE=4 SV=1
Length = 526

Score = 87.0 bits (214), Expect = 7e-16
Identities = 36/64 (56%), Positives = 51/64 (79%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT HWNQA+HG+T+N RK+F+E DQELFQEC+RK++E+EA A + E ++L W++LE+A
Sbjct: 428 NTRSHWNQAVHGLTLNVRKMFVEMDQELFQECQRKYEEDEAKAKGVGEMRDLTWKRLEIA 487

Query: 183 AASR 194
R
Sbjct: 488 GNPR 491


>tr|A9T630|A9T630_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_140830 PE=4 SV=1
Length = 520

Score = 85.5 bits (210), Expect = 2e-15
Identities = 33/65 (50%), Positives = 50/65 (76%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT HWNQA+HG+T+N RK+F+E DQ+LF EC+RK++E+EA A ++E + + W++LE A
Sbjct: 414 NTRSHWNQAVHGLTLNVRKMFMEMDQDLFHECQRKYREDEAKAKEVEEMREITWKRLEAA 473

Query: 183 AASRV 197
R+
Sbjct: 474 GNKRI 478


>tr|A9SNL8|A9SNL8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_132819 PE=4 SV=1
Length = 466

Score = 84.7 bits (208), Expect = 3e-15
Identities = 35/60 (58%), Positives = 48/60 (80%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT HWNQA+HG+T+N RK+FLE DQELFQEC+RK++E+EA A ++E + W++LE A
Sbjct: 360 NTRSHWNQAVHGLTLNVRKMFLEMDQELFQECQRKYQEDEAKAKGMEEVREQTWKRLEAA 419


>tr|A9SNL3|A9SNL3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_165920 PE=4 SV=1
Length = 433

Score = 84.7 bits (208), Expect = 3e-15
Identities = 35/60 (58%), Positives = 48/60 (80%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT HWNQA+HG+T+N RK+FLE DQELFQEC+RK++E+EA A ++E + W++LE A
Sbjct: 360 NTRSHWNQAVHGLTLNVRKMFLEMDQELFQECQRKYQEDEAKAKGMEEVREQTWKRLEAA 419


>tr|A7PHZ0|A7PHZ0_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018130001
PE=4 SV=1
Length = 502

Score = 83.2 bits (204), Expect = 1e-14
Identities = 36/66 (54%), Positives = 48/66 (72%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N GHWNQA+HGMT N R++FLE D ELF+EC R++ E+EA A L+E++ L W++LE
Sbjct: 430 NIRGHWNQAVHGMTANVRRMFLEMDAELFEECHRQYLEKEARAQELEEQRQLTWKRLEAV 489

Query: 183 AASRVG 200
AA G
Sbjct: 490 AAETGG 495


>tr|A5BY29|A5BY29_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_026308 PE=4 SV=1
Length = 131

Score = 83.2 bits (204), Expect = 1e-14
Identities = 36/66 (54%), Positives = 48/66 (72%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N GHWNQA+HGMT N R++FLE D ELF+EC R++ E+EA A L+E++ L W++LE
Sbjct: 59 NIRGHWNQAVHGMTANVRRMFLEMDAELFEECHRQYLEKEARAQELEEQRQLTWKRLEAV 118

Query: 183 AASRVG 200
AA G
Sbjct: 119 AAQTGG 124


>tr|A9TVY5|A9TVY5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_151591 PE=4 SV=1
Length = 480

Score = 80.9 bits (198), Expect = 5e-14
Identities = 34/64 (53%), Positives = 48/64 (75%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT HWNQ +H +T+N RK+F+E DQELFQEC RK++++ A A + EK+ W++LE A
Sbjct: 384 NTTSHWNQTVHTLTVNVRKMFMEMDQELFQECDRKYQDDVAKANSVDEKREETWRRLEAA 443

Query: 183 AASR 194
AA+R
Sbjct: 444 AATR 447


>tr|A9SJF2|A9SJF2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_213005 PE=4 SV=1
Length = 458

Score = 79.7 bits (195), Expect = 1e-13
Identities = 34/64 (53%), Positives = 46/64 (71%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
NT HWNQA+HG+T+N RK+FLE DQELF EC+RK+ E+EA A ++E + W++LE
Sbjct: 360 NTRSHWNQAVHGLTLNVRKMFLEMDQELFIECQRKYLEDEAKAQGVEEMRETTWKRLEAY 419

Query: 183 AASR 194
R
Sbjct: 420 GYQR 423


>tr|B6SWX8|B6SWX8_MAIZE Transposon protein OS=Zea mays PE=2 SV=1
Length = 522

Score = 77.4 bits (189), Expect = 5e-13
Identities = 30/66 (45%), Positives = 48/66 (72%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N + HWNQA+HG+T N RK+FL+ D ELF+EC++++ +++A A ++E++ W+QLE
Sbjct: 450 NIHSHWNQAVHGLTANVRKMFLDMDSELFEECQQQYMDKQAKAKEMQEQRESAWRQLEAV 509

Query: 183 AASRVG 200
AA G
Sbjct: 510 AAKAAG 515


>tr|Q9AYE5|Q9AYE5_ORYSJ Putative B' regulatory subunit of protein
phosphatase 2A, 5'-partial (Fragment) OS=Oryza sativa
subsp. japonica GN=OSJNBa0003G23.1 PE=4 SV=1
Length = 93

Score = 76.6 bits (187), Expect = 9e-13
Identities = 32/66 (48%), Positives = 48/66 (72%)
Frame = +3

Query: 3 NTNGHWNQAIHGMTMNARKLFLETDQELFQECKRKFKEEEANAVVLKEKQNLMWQQLEVA 182
N HWNQA+HG+T N RK+FL+ D ELF+EC++++ E++A A ++E++ W+QLE A
Sbjct: 21 NITSHWNQAVHGLTANVRKMFLDMDSELFEECQQQYIEKQARAKDMEEQRLSAWRQLEAA 80

Query: 183 AASRVG 200
AA G
Sbjct: 81 AAKASG 86