BP914864
Clone id YMU001_000063_G01
Library
Length 541
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_G01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATAGCATTGCCACTTGCAGTTATGACAATACTATTGCCATAATGAAATGGCCCTCTGTAC
AGAACCCAACATATGTACAACATCCCAACATGAACAATAGATGGATTTCAACATTCAGGG
CCATATGGGGTTGGGATGATGAATACATTTATGTGGGTAACATGAAGAGAACCACTGACC
TAATATCCACAAAATATGAGGCTGAATGCCATTGGCTGAGCAGCCCTCTAATGACATCGA
TTCCTTGTCGATTGGCCGCACATCCGATGAGGCGTGGCATTCTTGCAGGATGTACGGCCG
GTGGCCAAATCTACGTGTGGCGAGAGAACGTGGGGTGAGGGTAAAAGCCACTCTCTTTGG
TGTATAACATGGCTATGGCACAGGTGCATATATTAACTTGTAGTGAATTTCTCCCACATT
TAGTTGCTGCTTGGAGTTCAAATAGGAGAATATAGCTGTCGGTAACTTCTTCTTAGCAGT
GATCTTACAATGGGGAGCTTGTATTTCTGTATTCTATAGTGATGTCAAGGGCTACCAAAA
A
■■Homology search results ■■ -
sp_hit_id Q5KBC0
Definition sp|Q5KBC0|YD156_CRYNE WD repeat-containing protein CNI03070/CNBH2930 OS=Cryptococcus neoformans
Align length 103
Score (bit) 50.1
E-value 7.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914864|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_G01.
(541 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5KBC0|YD156_CRYNE WD repeat-containing protein CNI03070/CNBH... 50 7e-06
sp|Q7S1H9|YD156_NEUCR WD repeat-containing protein NCU09302/NCU1... 47 5e-05
sp|Q75BS7|YD156_ASHGO WD repeat-containing protein ACR194C OS=As... 47 5e-05
sp|Q6C0U2|YD156_YARLI WD repeat-containing protein YALI0F21747g ... 45 2e-04
sp|Q0UYV9|YD156_PHANO WD repeat-containing protein SNOG_03055 OS... 45 2e-04
sp|A7TL17|YD156_VANPO WD repeat-containing protein Kpol_530p43 O... 43 9e-04
sp|Q4PGT8|YD156_USTMA WD repeat-containing protein UM00675 OS=Us... 43 0.001
sp|Q12510|YD156_YEAST WD repeat-containing protein YDL156W OS=Sa... 42 0.002
sp|A5DAQ7|YD156_PICGU WD repeat-containing protein PGUG_00362 OS... 42 0.002
sp|A1DNV8|YD156_NEOFI WD repeat-containing protein NFIA_058290 O... 40 0.006
sp|Q5B6U3|YD156_EMENI WD repeat-containing protein AN3737 OS=Eme... 40 0.006
sp|Q6BKH9|YD156_DEBHA WD repeat-containing protein DEHA2F21868g ... 40 0.006
sp|Q4WLU1|YD156_ASPFU WD repeat-containing protein AFUA_6G12330 ... 40 0.006
sp|B0Y8S0|YD156_ASPFC WD repeat-containing protein AFUB_078330 O... 40 0.007
sp|Q2UUT4|YD156_ASPOR WD repeat-containing protein AO09000900018... 39 0.016
sp|A1CU75|YD156_ASPCL WD repeat-containing protein ACLA_085580 O... 39 0.016
sp|B2KIQ4|WDR76_RHIFE WD repeat-containing protein 76 OS=Rhinolo... 39 0.016
sp|Q2HHH2|YD156_CHAGB WD repeat-containing protein CHGG_00332 OS... 39 0.021
sp|Q4KLQ5|WDR76_XENLA WD repeat-containing protein 76 OS=Xenopus... 38 0.036
sp|A9X1C6|WDR76_PAPAN WD repeat-containing protein 76 OS=Papio a... 37 0.080
sp|Q9H967|WDR76_HUMAN WD repeat-containing protein 76 OS=Homo sa... 36 0.10
sp|A6PWY4|WDR76_MOUSE WD repeat-containing protein 76 OS=Mus mus... 36 0.14
sp|Q1E6Q0|YD156_COCIM WD repeat-containing protein CIMG_01763 OS... 35 0.23
sp|Q6CT00|YD156_KLULA WD repeat-containing protein KLLA0C16533g ... 32 1.5
sp|Q5KB95|SEC13_CRYNE Protein transport protein SEC13 OS=Cryptoc... 31 3.4
sp|Q59S45|YD156_CANAL WD repeat-containing protein CaJ7.0141/CaO... 30 5.7
sp|A4REK3|SEC13_MAGGR Protein transport protein SEC13 OS=Magnapo... 30 5.7
sp|P55735|SEC13_HUMAN Protein SEC13 homolog OS=Homo sapiens GN=S... 30 5.7
sp|Q10Y19|GLPK_TRIEI Glycerol kinase OS=Trichodesmium erythraeum... 30 7.6

>sp|Q5KBC0|YD156_CRYNE WD repeat-containing protein
CNI03070/CNBH2930 OS=Cryptococcus neoformans GN=CNI03070
PE=3 SV=1
Length = 595

Score = 50.1 bits (118), Expect = 7e-06
Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 4/103 (3%)
Frame = +3

Query: 24 DNTIAIMKWPSVQNPT-YVQHPNMNNRWISTFRAIWGWDDEYI---YVGNMKRTTDLIST 191
D + + P+ PT V+H RW++ RA W + EY+ VGNMKRT D++S
Sbjct: 488 DRAVGSLLQPNGFKPTKVVRHNCQTGRWLTILRAQWSLNMEYMPHFTVGNMKRTLDVVSA 547

Query: 192 KYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
E + L + +T++P A+HP + G G+I +W
Sbjct: 548 TGE-KIVGLWTDDVTAVPTVTASHPNIVDRVVGGNTSGRIQLW 589


>sp|Q7S1H9|YD156_NEUCR WD repeat-containing protein
NCU09302/NCU11420 OS=Neurospora crassa GN=NCU09302 PE=3
SV=1
Length = 521

Score = 47.4 bits (111), Expect = 5e-05
Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 20/125 (16%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPS--------------VQNPTYVQHPNMNNRWISTFRAIW----- 128
IAT SYD+ I I +PS +Q + H N RW++ + W
Sbjct: 400 IATSSYDDRIKIYSFPSAGEWKAGHDIPAKEMQPTVEIPHNNQTGRWVTILKPQWQRNPQ 459

Query: 129 -GWDDEYIYVGNMKRTTDLISTKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGG 305
GW + +GNM R D+ + E + L +T++P HP + + AG TA G
Sbjct: 460 DGW--QKFAIGNMNRFVDVYAEDGE-QLAQLGGDGITAVPAVAHFHPTKDWV-AGGTASG 515

Query: 306 QIYVW 320
++ +W
Sbjct: 516 KLCLW 520


>sp|Q75BS7|YD156_ASHGO WD repeat-containing protein ACR194C
OS=Ashbya gossypii GN=ACR194C PE=3 SV=1
Length = 513

Score = 47.4 bits (111), Expect = 5e-05
Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 5/99 (5%)
Frame = +3

Query: 21 YDNTIAIMK----WPSVQNPTY-VQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI 185
YDNT+ + PS P + +QH + RW+S +A + + + + NMKR D+
Sbjct: 408 YDNTVRLFNARADLPSELQPDFTIQHNCKSGRWVSVLKARFKLNMDVFAIANMKRAIDIY 467

Query: 186 STKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAG 302
+++ E H +S ++P ++ HPM+ I+ G +G
Sbjct: 468 TSRGEQLSHLETS----TVPAVVSWHPMQNWIVGGNNSG 502


>sp|Q6C0U2|YD156_YARLI WD repeat-containing protein YALI0F21747g
OS=Yarrowia lipolytica GN=YALI0F21747g PE=3 SV=1
Length = 539

Score = 45.4 bits (106), Expect = 2e-04
Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 5/101 (4%)
Frame = +3

Query: 33 IAIMKWPSVQNPTY-VQHPNMNNRWISTFRAIWGWDD----EYIYVGNMKRTTDLISTKY 197
I+ + P ++ P+ ++H RW++ +A W + + NM R D+ S
Sbjct: 440 ISDQELPEIKKPSVRIKHNCQTGRWVTILKARWQQQPLDGVQKFAIANMNRYIDIYSGTG 499

Query: 198 EAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
H L LMT++P LA HP + I AG + G++Y W
Sbjct: 500 HQLAH-LGDALMTAVPSALAFHPTQNWI-AGGNSSGKMYWW 538


>sp|Q0UYV9|YD156_PHANO WD repeat-containing protein SNOG_03055
OS=Phaeosphaeria nodorum GN=SNOG_03055 PE=3 SV=1
Length = 519

Score = 45.4 bits (106), Expect = 2e-04
Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 18/123 (14%)
Frame = +3

Query: 6 IATCSYDNTIAI------MKWPS--------VQNPTYVQHPNMNNRWISTFRAIWGW--- 134
+AT SYD+TI I +W + ++ V H N RW++ RA W
Sbjct: 398 VATASYDDTIKIHDFSKSAEWATGTALTDADMKPSVVVPHNNQTGRWVTILRAQWQQFPQ 457

Query: 135 -DDEYIYVGNMKRTTDLISTKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQI 311
+ +GNM R D+ + K + + L +T++P HP + AG TA G++
Sbjct: 458 DGVQRFCIGNMNRFVDIYTAKGQ-QLAQLGGDGITAVPAVAKFHPTLDWVAAG-TASGKL 515

Query: 312 YVW 320
+W
Sbjct: 516 CLW 518


>sp|A7TL17|YD156_VANPO WD repeat-containing protein Kpol_530p43
OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM
70294) GN=Kpol_530p43 PE=3 SV=1
Length = 536

Score = 43.1 bits (100), Expect = 9e-04
Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 6/108 (5%)
Frame = +3

Query: 21 YDNTIAIMKWPSVQNPTYVQ------HPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDL 182
YD+TI + S P +Q H + RW S +A + D + + NMKR D+
Sbjct: 425 YDDTIRLFDVGSDNLPDDLQPKLTLKHNCQSGRWTSILKARFKQDQDVFAIANMKRAIDI 484

Query: 183 ISTKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVWRE 326
Y+++ L+ ++P ++ HP+R I AG + G+I+++ +
Sbjct: 485 ----YDSQGQQLAHLPTATVPAVISWHPLRNWI-AGGNSSGKIFLFTD 527


>sp|Q4PGT8|YD156_USTMA WD repeat-containing protein UM00675
OS=Ustilago maydis GN=UM00675 PE=3 SV=1
Length = 637

Score = 42.7 bits (99), Expect = 0.001
Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 3/89 (3%)
Frame = +3

Query: 63 NPTYVQHPNMNNRWISTFRAIWGWD---DEYIYVGNMKRTTDLISTKYEAECHWLSSPLM 233
NPT + H N +W++ FRA W + + + +G+M R ++ + L+
Sbjct: 545 NPTRIPHNNQTGKWLTLFRAKWNQNALLEPHFTIGSMSRRAEVYAADGTLLRSLWDENLV 604

Query: 234 TSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
T++P HP+ L A G+ W
Sbjct: 605 TAVPAVTCMHPVLPARLVTGNASGRCTFW 633


>sp|Q12510|YD156_YEAST WD repeat-containing protein YDL156W
OS=Saccharomyces cerevisiae GN=YDL156W PE=1 SV=1
Length = 522

Score = 42.0 bits (97), Expect = 0.002
Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 7/112 (6%)
Frame = +3

Query: 21 YDNTIAIMKWPS-------VQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTD 179
YD+TI + S ++ +QH RW S +A + + + NMKR D
Sbjct: 410 YDDTIRLFDVKSRDHLSAKLEPKLTIQHNCQTGRWTSILKARFKPNKNVFAIANMKRAID 469

Query: 180 LISTKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVWRENVG 335
+ Y +E L+ ++P ++ HP+R I AG + G+I+++ ++ G
Sbjct: 470 I----YNSEGQQLAHLPTATVPAVISWHPLRNWI-AGGNSSGKIFLFTDDSG 516


>sp|A5DAQ7|YD156_PICGU WD repeat-containing protein PGUG_00362
OS=Pichia guilliermondii GN=PGUG_00362 PE=3 SV=2
Length = 573

Score = 41.6 bits (96), Expect = 0.002
Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 4/88 (4%)
Frame = +3

Query: 69 TYVQHPNMNNRWISTFRAIWGWDD----EYIYVGNMKRTTDLISTKYEAECHWLSSPLMT 236
T ++H RW+S ++ W + + NM R D+ K CH MT
Sbjct: 486 TRIKHNCQTGRWVSILKSKWQLHPADGLQKFVIANMNRAFDIYDQKGRILCHLTDPDRMT 545

Query: 237 SIPCRLAAHPMRRGILAGCTAGGQIYVW 320
++P HP + G +A G++Y++
Sbjct: 546 AVPAVSMLHPTENWCVGG-SASGKVYLF 572


>sp|A1DNV8|YD156_NEOFI WD repeat-containing protein NFIA_058290
OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 /
NRRL 181) GN=NFIA_058290 PE=3 SV=1
Length = 527

Score = 40.4 bits (93), Expect = 0.006
Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 20/125 (16%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPS----------------VQNPTYVQHPNMNNRWISTFRAIWGWD 137
IAT SYD+T+ I + S ++ T V+H RW++ R W +
Sbjct: 404 IATSSYDDTLKIYDFGSKGIAAWKPGHTLSDAEMKPDTIVRHNCQTGRWVTILRPQWQAN 463

Query: 138 D----EYIYVGNMKRTTDLISTKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGG 305
+ +GNM R D+ S+ + + L +T++P H I AG TA G
Sbjct: 464 PQSPIQRFCIGNMNRFVDVYSSSGD-QLAQLGGDGITAVPAVAVFHRSTNWI-AGGTASG 521

Query: 306 QIYVW 320
+I +W
Sbjct: 522 KICLW 526


tr_hit_id A7QS01
Definition tr|A7QS01|A7QS01_VITVI Chromosome undetermined scaffold_155, whole genome shotgun sequence OS=Vitis vinifera
Align length 107
Score (bit) 116.0
E-value 9.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914864|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_G01.
(541 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QS01|A7QS01_VITVI Chromosome undetermined scaffold_155, who... 116 9e-25
tr|Q9SAI7|Q9SAI7_ARATH F23A5.6 protein OS=Arabidopsis thaliana G... 113 6e-24
tr|Q6YS10|Q6YS10_ORYSJ Os08g0282500 protein OS=Oryza sativa subs... 89 1e-16
tr|A3BRI6|A3BRI6_ORYSJ Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|A2YTG5|A2YTG5_ORYSI Putative uncharacterized protein OS=Oryza... 87 4e-16
tr|Q6YZ25|Q6YZ25_ORYSJ Transducin / WD-40 repeat protein-like OS... 70 9e-11
tr|Q0J6Q2|Q0J6Q2_ORYSJ Os08g0285200 protein (Fragment) OS=Oryza ... 70 9e-11
tr|B7F4I5|B7F4I5_ORYSJ cDNA clone:001-115-E05, full insert seque... 70 9e-11
tr|A3BRJ0|A3BRJ0_ORYSJ Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|A2YTH1|A2YTH1_ORYSI Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|A8I388|A8I388_CHLRE Predicted protein OS=Chlamydomonas reinha... 55 2e-06
tr|A4S1W2|A4S1W2_OSTLU Predicted protein OS=Ostreococcus lucimar... 53 1e-05
tr|A7RGG5|A7RGG5_NEMVE Predicted protein OS=Nematostella vectens... 52 2e-05
tr|A7ERM4|A7ERM4_SCLS1 Putative uncharacterized protein OS=Scler... 50 1e-04
tr|A6SJ03|A6SJ03_BOTFB Putative uncharacterized protein OS=Botry... 48 3e-04
tr|B2WNS3|B2WNS3_PYRTR WD repeat containing protein OS=Pyrenopho... 46 0.001
tr|B6M0I0|B6M0I0_BRAFL Putative uncharacterized protein (Fragmen... 44 0.004
tr|B6M0H1|B6M0H1_BRAFL Putative uncharacterized protein OS=Branc... 44 0.005
tr|Q012S7|Q012S7_OSTTA Low-CO2 inducible protein LCIB (ISS) (Fra... 43 0.012
tr|A6R6P2|A6R6P2_AJECN Putative uncharacterized protein OS=Ajell... 43 0.012
tr|B2AM83|B2AM83_PODAN Predicted CDS Pa_5_6590 OS=Podospora anse... 42 0.016
tr|B3LH43|B3LH43_YEAS1 Putative uncharacterized protein OS=Sacch... 42 0.020
tr|A6ZXH3|A6ZXH3_YEAS7 Conserved protein OS=Saccharomyces cerevi... 42 0.020
tr|B6HSM0|B6HSM0_PENCH Pc22g04060 protein OS=Penicillium chrysog... 39 0.13
tr|B8NS39|B8NS39_ASPFL WD domain protein OS=Aspergillus flavus N... 39 0.17
tr|B7QCD2|B7QCD2_IXOSC Putative uncharacterized protein OS=Ixode... 38 0.30
tr|B7NZF6|B7NZF6_RABIT WD repeat domain 76 (Predicted) OS=Orycto... 38 0.39
tr|B6QEQ4|B6QEQ4_PENMA WD domain protein OS=Penicillium marneffe... 38 0.39
tr|A8NF75|A8NF75_COPC7 Putative uncharacterized protein OS=Copri... 38 0.39
tr|A9V5B9|A9V5B9_MONBE Predicted protein OS=Monosiga brevicollis... 37 0.66

>tr|A7QS01|A7QS01_VITVI Chromosome undetermined scaffold_155, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00005613001 PE=4 SV=1
Length = 431

Score = 116 bits (290), Expect = 9e-25
Identities = 51/107 (47%), Positives = 73/107 (68%)
Frame = +3

Query: 3 SIATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDL 182
S+AT S +N + ++ + ++ + + H N RWIS+FRAIWGWDD Y+++GNMKR D+
Sbjct: 323 SLATTSVENKVGLLGGVNFEDLSMIYHENHMCRWISSFRAIWGWDDSYLFIGNMKRGVDI 382

Query: 183 ISTKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVWR 323
IST L S M++IPCR +AHP + G+LAG T GGQIY+W+
Sbjct: 383 ISTACRKTVMTLQSAHMSAIPCRFSAHPYKVGMLAGATGGGQIYMWK 429


>tr|Q9SAI7|Q9SAI7_ARATH F23A5.6 protein OS=Arabidopsis thaliana
GN=At1g80710 PE=4 SV=1
Length = 516

Score = 113 bits (283), Expect = 6e-24
Identities = 51/106 (48%), Positives = 69/106 (65%)
Frame = +3

Query: 3 SIATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDL 182
S+AT S DN I ++ + +N + H N +RWIS F+A+WGWDD YIYVGN+ + D+
Sbjct: 409 SLATTSLDNYIGVLSGANFENTCMIYHNN-TSRWISKFKAVWGWDDSYIYVGNLSKKIDV 467

Query: 183 ISTKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
I+ K + L +PL +IPCR+ HP G LAG TAGGQ+YVW
Sbjct: 468 INPKLKRTVMELHNPLQRAIPCRIHCHPYNVGTLAGSTAGGQVYVW 513


>tr|Q6YS10|Q6YS10_ORYSJ Os08g0282500 protein OS=Oryza sativa subsp.
japonica GN=B1446H11.26 PE=2 SV=1
Length = 457

Score = 89.0 bits (219), Expect = 1e-16
Identities = 43/111 (38%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI 185
+AT S D+T+ I N + ++H N RW+STF+AIWGW+D +++GNM R D+I
Sbjct: 344 VATTSLDDTVRIFSVDDFGNSSIMKHNNKTGRWLSTFKAIWGWNDTDLFIGNMARAIDII 403

Query: 186 ------STKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
S+ L S MT+IP R +AHP + G LA ++GG++++W
Sbjct: 404 LVDLNGSSLLAMNNARLESEHMTAIPGRFSAHPYKVGHLACASSGGKVFLW 454


>tr|A3BRI6|A3BRI6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_025658 PE=4 SV=1
Length = 348

Score = 89.0 bits (219), Expect = 1e-16
Identities = 43/111 (38%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI 185
+AT S D+T+ I N + ++H N RW+STF+AIWGW+D +++GNM R D+I
Sbjct: 235 VATTSLDDTVRIFSVDDFGNSSIMKHNNKTGRWLSTFKAIWGWNDTDLFIGNMARAIDII 294

Query: 186 ------STKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
S+ L S MT+IP R +AHP + G LA ++GG++++W
Sbjct: 295 LVDLNGSSLLAMNNARLESEHMTAIPGRFSAHPYKVGHLACASSGGKVFLW 345


>tr|A2YTG5|A2YTG5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_28605 PE=4 SV=1
Length = 573

Score = 87.4 bits (215), Expect = 4e-16
Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 6/108 (5%)
Frame = +3

Query: 15 CSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI--- 185
CS D+T+ I N + ++H N RW+STF+AIWGW+D +++GNM R D+I
Sbjct: 463 CSLDDTVRIFSVDDFGNSSIMKHNNKTGRWLSTFKAIWGWNDTDLFIGNMARAIDIILVD 522

Query: 186 ---STKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
S+ L S MT IP R +AHP + G LA ++GG++++W
Sbjct: 523 LNGSSLLAMNNARLESEHMTPIPGRFSAHPYKVGHLACASSGGKVFLW 570



Score = 86.7 bits (213), Expect = 7e-16
Identities = 44/114 (38%), Positives = 66/114 (57%), Gaps = 6/114 (5%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI 185
+AT S D+T+ I N + ++H N RW+STF+AIWGW+D +++GNM R D+I
Sbjct: 344 VATTSLDDTVRIFSVDDFGNSSIMKHNNKTGRWLSTFKAIWGWNDTDLFIGNMARAIDII 403

Query: 186 ------STKYEAECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVWREN 329
S+ L S MT+IP R +AHP + G LA ++GG++ + R N
Sbjct: 404 LVDLNGSSLLAMNNARLESEHMTAIPGRFSAHPYKVGHLACASSGGKVLLHRNN 457


>tr|Q6YZ25|Q6YZ25_ORYSJ Transducin / WD-40 repeat protein-like
OS=Oryza sativa subsp. japonica GN=P0436B05.25 PE=4 SV=1
Length = 524

Score = 69.7 bits (169), Expect = 9e-11
Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI 185
+AT S D + + + +N V+ N +STF+AIWGW+D +++GN R D+I
Sbjct: 411 VATTSLDGIVRVFSVDNFENFHTVERNNNIGTHLSTFKAIWGWNDMDLFIGNATRAIDVI 470

Query: 186 STKYE------AECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
S L S M SIP R +AHP + G LA ++ G++++W
Sbjct: 471 SVDLNDSSISTTNNACLKSEHMVSIPYRFSAHPCKVGHLACSSSSGKVFLW 521


>tr|Q0J6Q2|Q0J6Q2_ORYSJ Os08g0285200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os08g0285200 PE=4 SV=1
Length = 488

Score = 69.7 bits (169), Expect = 9e-11
Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI 185
+AT S D + + + +N V+ N +STF+AIWGW+D +++GN R D+I
Sbjct: 375 VATTSLDGIVRVFSVDNFENFHTVERNNNIGTHLSTFKAIWGWNDMDLFIGNATRAIDVI 434

Query: 186 STKYE------AECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
S L S M SIP R +AHP + G LA ++ G++++W
Sbjct: 435 SVDLNDSSISTTNNACLKSEHMVSIPYRFSAHPCKVGHLACSSSSGKVFLW 485


>tr|B7F4I5|B7F4I5_ORYSJ cDNA clone:001-115-E05, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 449

Score = 69.7 bits (169), Expect = 9e-11
Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
Frame = +3

Query: 6 IATCSYDNTIAIMKWPSVQNPTYVQHPNMNNRWISTFRAIWGWDDEYIYVGNMKRTTDLI 185
+AT S D + + + +N V+ N +STF+AIWGW+D +++GN R D+I
Sbjct: 336 VATTSLDGIVRVFSVDNFENFHTVERNNNIGTHLSTFKAIWGWNDMDLFIGNATRAIDVI 395

Query: 186 STKYE------AECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQIYVW 320
S L S M SIP R +AHP + G LA ++ G++++W
Sbjct: 396 SVDLNDSSISTTNNACLKSEHMVSIPYRFSAHPCKVGHLACSSSSGKVFLW 446


>tr|A3BRJ0|A3BRJ0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_025662 PE=4 SV=1
Length = 416

Score = 59.3 bits (142), Expect = 1e-07
Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 19/124 (15%)
Frame = +3

Query: 6 IATCSYDNTIAI-----MKWPSVQNPTYVQHP--------NMNNRWISTFRAIWGWDDEY 146
+AT S D T + MK ++ ++H + + ++T RAIWGW+D
Sbjct: 290 LATSSRDGTACMWDLRTMKKKGAESLVVLEHDRGLQSAYFSPSGHMVATTRAIWGWNDMD 349

Query: 147 IYVGNMKRTTDLISTKYE------AECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQ 308
+++GN R D+IS L S M SIP R +AHP + G LA ++ G+
Sbjct: 350 LFIGNATRAIDVISVDLNDSSISTTNNACLKSEHMVSIPYRFSAHPCKVGHLACSSSSGK 409

Query: 309 IYVW 320
+++W
Sbjct: 410 VFLW 413


>tr|A2YTH1|A2YTH1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_28611 PE=4 SV=1
Length = 416

Score = 59.3 bits (142), Expect = 1e-07
Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 19/124 (15%)
Frame = +3

Query: 6 IATCSYDNTIAI-----MKWPSVQNPTYVQHP--------NMNNRWISTFRAIWGWDDEY 146
+AT S D T + MK ++ ++H + + ++T RAIWGW+D
Sbjct: 290 LATSSRDGTACMWDLRTMKKKGAESLVVLEHDRGLQSAYFSPSGHMVATTRAIWGWNDMD 349

Query: 147 IYVGNMKRTTDLISTKYE------AECHWLSSPLMTSIPCRLAAHPMRRGILAGCTAGGQ 308
+++GN R D+IS L S M SIP R +AHP + G LA ++ G+
Sbjct: 350 LFIGNATRAIDVISVDLNDSSISTTNNACLKSEHMVSIPYRFSAHPCKVGHLACSSSSGK 409

Query: 309 IYVW 320
+++W
Sbjct: 410 VFLW 413