BP914880
Clone id YMU001_000063_H07
Library
Length 465
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000063_H07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGAAGAGTCCTGTCTTCCTCACTTAATATACATATCAACCAGGGAATTCGCAAATACAG
TATCTGACTCATGCCTCCTCATGATAACCTGACAATGAATTAGTCTACCTTCAAGTGCAA
CACCTAACACGCCACAAGCCCTCAATGCACTTAGAAAGGTGACATCATCTGGCACAAGAC
CCTTTTGACCCATGTTTCAAATGTCTGTAGTGCTGACAATGCAAGCCCTTGATGTGCATA
ACCTCCAATCATCAAGTTCCAAGTCACCACATTCTTATTTGGCAACAAGTCAAACAATTT
ATTGGCCTCTACAATAAGGCCCACTTTGCAATACATGTCAAGGAGGGCATGCCCAACAGA
AACATCCAGTGCATCATTGCACTCAAGTGTAACAAAGTGCGCCAAAAAACATTCCTCCAT
TTCACCCACATCAATACATGCTTTTGCAATGGACGAAAGAGTAAA
■■Homology search results ■■ -
sp_hit_id Q0WNP3
Definition sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein At4g18520 OS=Arabidopsis thaliana
Align length 97
Score (bit) 62.8
E-value 5.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914880|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_H07.
(465 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 64 5e-17
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 67 9e-16
sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protei... 64 1e-15
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 62 4e-15
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 69 5e-15
sp|Q9ZUT4|PP192_ARATH Pentatricopeptide repeat-containing protei... 70 1e-14
sp|Q9LJR6|PP253_ARATH Putative pentatricopeptide repeat-containi... 51 2e-14
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 59 3e-14
sp|Q9SII7|PP159_ARATH Pentatricopeptide repeat-containing protei... 58 3e-14
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 63 3e-14
sp|O49619|PP350_ARATH Pentatricopeptide repeat-containing protei... 60 3e-14
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 64 3e-14
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 55 6e-14
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 55 6e-14
sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protei... 64 6e-14
sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protei... 56 6e-14
sp|Q5XEY7|PP309_ARATH Pentatricopeptide repeat-containing protei... 56 6e-14
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 60 1e-13
sp|Q9SS97|PP205_ARATH Putative pentatricopeptide repeat-containi... 58 2e-13
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 59 2e-13
sp|Q9SZK1|PP355_ARATH Pentatricopeptide repeat-containing protei... 66 2e-13
sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protei... 59 2e-13
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 57 3e-13
sp|Q56X05|PPR15_ARATH Pentatricopeptide repeat-containing protei... 66 4e-13
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 63 5e-13
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 64 6e-13
sp|Q9SUF9|PP305_ARATH Pentatricopeptide repeat-containing protei... 54 8e-13
sp|Q9LFL5|PP390_ARATH Putative pentatricopeptide repeat-containi... 55 1e-12
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 64 1e-12
sp|Q9XE98|PP303_ARATH Pentatricopeptide repeat-containing protei... 53 1e-12

>sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein
At4g18520 OS=Arabidopsis thaliana GN=PCMP-A2 PE=2 SV=1
Length = 617

Score = 62.8 bits (151), Expect(2) = 5e-17
Identities = 34/97 (35%), Positives = 51/97 (52%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT+ SI KAC + + H + ++ DV VG +L+DMY K G I + K+FD
Sbjct: 285 FTVCSILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGTSLMDMYAKCGEISDCRKVFDG 344

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWVKRVL 175
+ N+N VTW +I +A +G A+ F +R L
Sbjct: 345 MSNRNTVTWTSIIAAHAREGFGEEAISLFRIMKRRHL 381



Score = 43.9 bits (102), Expect(2) = 5e-17
Identities = 21/59 (35%), Positives = 36/59 (61%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M ++ L+ +++T +S LRACG +G L G+ +H Q+I E + ++LV +Y K G
Sbjct: 376 MKRRHLIANNLTVVSILRACGSVGALLLGKELHAQIIKNSIEKNVYIGSTLVWLYCKCG 434



Score = 63.5 bits (153), Expect = 4e-10
Identities = 34/87 (39%), Positives = 48/87 (55%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT SS KAC + + H + + + +V VG AL+ MY K G + EA ++FD
Sbjct: 487 FTYSSALKACANSESLLIGRSIHSIAKKNHALSNVFVGSALIHMYAKCGFVSEAFRVFDS 546

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQ 205
+P KN+V+W MI GYA G AL+
Sbjct: 547 MPEKNLVSWKAMIMGYARNGFCREALK 573



Score = 44.3 bits (103), Expect(2) = 1e-09
Identities = 27/93 (29%), Positives = 47/93 (50%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T+ SI +AC VG + H ++ + +V +G L+ +YCK G +A + L
Sbjct: 387 TVVSILRACGSVGALLLGKELHAQIIKNSIEKNVYIGSTLVWLYCKCGESRDAFNVLQQL 446

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFETWVK 184
P+++VV+W MI G + G AL + ++
Sbjct: 447 PSRDVVSWTAMISGCSSLGHESEALDFLKEMIQ 479



Score = 37.4 bits (85), Expect(2) = 1e-09
Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANS-LVDMYIK*G 17
M Q+G+ P+ T+ SAL+AC L GR IH + + H VF S L+ MY K G
Sbjct: 477 MIQEGVEPNPFTYSSALKACANSESLLIGRSIH-SIAKKNHALSNVFVGSALIHMYAKCG 535



Score = 57.8 bits (138), Expect = 2e-08
Identities = 29/72 (40%), Positives = 40/72 (55%)
Frame = -1

Query: 399 HFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLA 220
H + L+C D + G+ L+ ++G +V A K+FD +P KN VTW MI GY GL
Sbjct: 105 HAMALKCFDDQVIYFGNNLISSCVRLGDLVYARKVFDSMPEKNTVTWTAMIDGYLKYGLE 164

Query: 219 LSALQTFETWVK 184
A FE +VK
Sbjct: 165 DEAFALFEDYVK 176



Score = 37.4 bits (85), Expect(2) = 1e-06
Identities = 19/53 (35%), Positives = 28/53 (52%)
Frame = -3

Query: 175 VPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
+P++ T S L+AC GR +H V+ R ++D SL+DMY K G
Sbjct: 281 LPNEFTVCSILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGTSLMDMYAKCG 333



Score = 33.9 bits (76), Expect(2) = 1e-06
Identities = 14/53 (26%), Positives = 29/53 (54%)
Frame = -1

Query: 357 VGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
V +L+ Y + G + A + FD++ K+V++W +I + +G + A+ F
Sbjct: 220 VESSLVYFYAQCGELTSALRAFDMMEEKDVISWTAVISACSRKGHGIKAIGMF 272


>sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containing
protein At3g15130 OS=Arabidopsis thaliana GN=PCMP-H86
PE=3 SV=1
Length = 689

Score = 67.0 bits (162), Expect(2) = 9e-16
Identities = 34/89 (38%), Positives = 52/89 (58%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT S+ KAC + +E+ H L+ + V VG++L+DMY K G I EA K+F
Sbjct: 108 FTFSTNLKACGLLNALEKGLQIHGFCLKIGFEMMVEVGNSLVDMYSKCGRINEAEKVFRR 167

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+ ++++++WN MI G+ H G AL TF
Sbjct: 168 IVDRSLISWNAMIAGFVHAGYGSKALDTF 196



Score = 35.4 bits (80), Expect(2) = 9e-16
Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHE--SDTVFANSLVDMYIK*G 17
PD+ T S L+AC G+ G+ IH ++ S SLVD+Y+K G
Sbjct: 208 PDEFTLTSLLKACSSTGMIYAGKQIHGFLVRSGFHCPSSATITGSLVDLYVKCG 261



Score = 52.4 bits (124), Expect(2) = 7e-15
Identities = 27/87 (31%), Positives = 45/87 (51%)
Frame = -1

Query: 459 LSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLP 280
L SI + C G ++ H L+ L++ + L+DMYCK + A K+FD +P
Sbjct: 9 LVSILRVCTRKGLSDQGGQVHCYLLKSGSGLNLITSNYLIDMYCKCREPLMAYKVFDSMP 68

Query: 279 NKNVVTWNLMIGGYAHQGLALSALQTF 199
+NVV+W+ ++ G+ G +L F
Sbjct: 69 ERNVVSWSALMSGHVLNGDLKGSLSLF 95



Score = 47.0 bits (110), Expect(2) = 7e-15
Identities = 25/60 (41%), Positives = 35/60 (58%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
MG++G+ P++ TF + L+ACG+L +G IH + E NSLVDMY K GR
Sbjct: 98 MGRQGIYPNEFTFSTNLKACGLLNALEKGLQIHGFCLKIGFEMMVEVGNSLVDMYSKCGR 157



Score = 52.8 bits (125), Expect(2) = 1e-08
Identities = 28/89 (31%), Positives = 48/89 (53%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
F LSSI D + + + ++ L+ SV ++++DMY K GL+ EA K F
Sbjct: 314 FALSSIIGVFADFALLRQGKQMQALAVKLPSGLETSVLNSVVDMYLKCGLVDEAEKCFAE 373

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+ K+V++W ++I GY GL +++ F
Sbjct: 374 MQLKDVISWTVVITGYGKHGLGKKSVRIF 402



Score = 25.4 bits (54), Expect(2) = 1e-08
Identities = 11/37 (29%), Positives = 21/37 (56%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVI 83
M + + PD+V +L+ L AC G+ EG + +++
Sbjct: 405 MLRHNIEPDEVCYLAVLSACSHSGMIKEGEELFSKLL 441



Score = 50.4 bits (119), Expect = 4e-06
Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAH--FVTLECNDALDVSVGHALLDMYCKVGLIVEANKLF 292
FTL+S+ KAC G + H V + ++ +L+D+Y K G + A K F
Sbjct: 211 FTLTSLLKACSSTGMIYAGKQIHGFLVRSGFHCPSSATITGSLVDLYVKCGYLFSARKAF 270

Query: 291 DLLPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
D + K +++W+ +I GYA +G + A+ F+
Sbjct: 271 DQIKEKTMISWSSLILGYAQEGEFVEAMGLFK 302



Score = 32.0 bits (71), Expect = 1.3
Identities = 14/44 (31%), Positives = 25/44 (56%)
Frame = -3

Query: 154 LSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK 23
+S LR C G++ +G +HC ++ + + +N L+DMY K
Sbjct: 10 VSILRVCTRKGLSDQGGQVHCYLLKSGSGLNLITSNYLIDMYCK 53


>sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protein
At3g13880 OS=Arabidopsis thaliana GN=PCMP-E89 PE=2 SV=1
Length = 748

Score = 64.3 bits (155), Expect(2) = 1e-15
Identities = 35/79 (44%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
Frame = -1

Query: 465 FTLSSIAKAC---IDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKL 295
+ L S+ KAC ++ G +E+ H T + D+ V ALLDMY K G + EA KL
Sbjct: 250 YALGSVLKACCINLNEGFIEKGMAIHCYTAKLGMEFDIVVRTALLDMYAKNGSLKEAIKL 309

Query: 294 FDLLPNKNVVTWNLMIGGY 238
F L+P+KNVVT+N MI G+
Sbjct: 310 FSLMPSKNVVTYNAMISGF 328



Score = 37.4 bits (85), Expect(2) = 1e-15
Identities = 17/56 (30%), Positives = 28/56 (50%)
Frame = -3

Query: 196 NMGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMY 29
+M ++GL P TF L+AC GR IH + +SD ++L+++Y
Sbjct: 348 DMQRRGLEPSPSTFSVVLKACSAAKTLEYGRQIHALICKNNFQSDEFIGSALIELY 403



Score = 45.4 bits (106), Expect(2) = 3e-08
Identities = 19/49 (38%), Positives = 31/49 (63%)
Frame = -1

Query: 345 LLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
LL+MYCK + A +LFD +P +N++++N +I GY G A++ F
Sbjct: 88 LLNMYCKCRELGFARQLFDRMPERNIISFNSLISGYTQMGFYEQAMELF 136



Score = 31.2 bits (69), Expect(2) = 3e-08
Identities = 18/56 (32%), Positives = 25/56 (44%)
Frame = -3

Query: 169 DDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQDSS 2
D T+ AL CG G L+H V++ N L+DMY K G+ D +
Sbjct: 147 DKFTYAGALGFCGERCDLDLGELLHGLVVVNGLSQQVFLINVLIDMYSKCGKLDQA 202



Score = 42.0 bits (97), Expect(2) = 1e-06
Identities = 24/72 (33%), Positives = 38/72 (52%)
Frame = -1

Query: 435 IDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWN 256
+D+GE L H + + + V + + L+DMY K G + +A LFD ++ V+WN
Sbjct: 164 LDLGE-----LLHGLVVVNGLSQQVFLINVLIDMYSKCGKLDQAMSLFDRCDERDQVSWN 218

Query: 255 LMIGGYAHQGLA 220
+I GY G A
Sbjct: 219 SLISGYVRVGAA 230



Score = 29.3 bits (64), Expect(2) = 1e-06
Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
Frame = -3

Query: 151 SALRACGVL---GVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
S L+AC + G +G IHC E D V +L+DMY K G
Sbjct: 254 SVLKACCINLNEGFIEKGMAIHCYTAKLGMEFDIVVRTALLDMYAKNG 301


>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein
At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=2 SV=1
Length = 697

Score = 61.6 bits (148), Expect(2) = 4e-15
Identities = 29/90 (32%), Positives = 52/90 (57%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
++ +S+ AC + +M + H + + DV +G AL+DMY K G + +A ++FD
Sbjct: 153 YSFASVLSACSGLNDMNKGVQVHSLIAKSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDE 212

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+ ++NVV+WN +I + G A+ AL F+
Sbjct: 213 MGDRNVVSWNSLITCFEQNGPAVEALDVFQ 242



Score = 38.5 bits (88), Expect(2) = 4e-15
Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMR-RHESDTVFANSLVDMYIK*GR 14
PD+VT S + AC L G+ +H +V+ + +D + +N+ VDMY K R
Sbjct: 251 PDEVTLASVISACASLSAIKVGQEVHGRVVKNDKLRNDIILSNAFVDMYAKCSR 304



Score = 58.2 bits (139), Expect(2) = 4e-11
Identities = 31/95 (32%), Positives = 51/95 (53%), Gaps = 6/95 (6%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTL------ECNDALDVSVGHALLDMYCKVGLIVEA 304
++ ++I KAC D+ E+ AH L + + D+ VG++L+DMY K G + E
Sbjct: 387 YSFANILKACADLAELHLGMQAHVHVLKHGFKFQSGEEDDIFVGNSLIDMYVKCGCVEEG 446

Query: 303 NKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+F + ++ V+WN MI G+A G AL+ F
Sbjct: 447 YLVFRKMMERDCVSWNAMIIGFAQNGYGNEALELF 481



Score = 28.5 bits (62), Expect(2) = 4e-11
Identities = 13/30 (43%), Positives = 16/30 (53%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGR 104
M + G PD +T + L ACG G EGR
Sbjct: 484 MLESGEKPDHITMIGVLSACGHAGFVEEGR 513



Score = 47.4 bits (111), Expect(2) = 4e-09
Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDAL--DVSVGHALLDMYCKVGLIVEANKLFD 289
TL+S+ AC + ++ H ++ ND L D+ + +A +DMY K I EA +FD
Sbjct: 255 TLASVISACASLSAIKVGQEVHGRVVK-NDKLRNDIILSNAFVDMYAKCSRIKEARFIFD 313

Query: 288 LLPNKNVVTWNLMIGGYAHQGLALSALQTFETWVKR 181
+P +NV+ MI GYA +A F +R
Sbjct: 314 SMPIRNVIAETSMISGYAMAASTKAARLMFTKMAER 349



Score = 32.3 bits (72), Expect(2) = 4e-09
Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%)
Frame = -3

Query: 187 QKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVI-----MRRHESDTVFA-NSLVDMYI 26
++ + P +F + L+AC L G H V+ + E D +F NSL+DMY+
Sbjct: 379 RESVCPTHYSFANILKACADLAELHLGMQAHVHVLKHGFKFQSGEEDDIFVGNSLIDMYV 438

Query: 25 K*G 17
K G
Sbjct: 439 KCG 441



Score = 35.4 bits (80), Expect(2) = 2e-06
Identities = 16/43 (37%), Positives = 24/43 (55%)
Frame = -1

Query: 327 KVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
K+G + EA+ LF +P ++ TWN M+ G+A AL F
Sbjct: 98 KLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEEALCYF 140



Score = 35.4 bits (80), Expect(2) = 2e-06
Identities = 20/59 (33%), Positives = 30/59 (50%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M ++G V ++ +F S L AC L +G +H + SD ++LVDMY K G
Sbjct: 143 MHKEGFVLNEYSFASVLSACSGLNDMNKGVQVHSLIAKSPFLSDVYIGSALVDMYSKCG 201



Score = 44.3 bits (103), Expect = 3e-04
Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
Frame = -1

Query: 399 HFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLA 220
H ++ + ++ + + L+D Y K G + + ++FD +P +N+ TWN ++ G G
Sbjct: 43 HASVIKSGFSNEIFIQNRLIDAYSKCGSLEDGRQVFDKMPQRNIYTWNSVVTGLTKLGFL 102

Query: 219 LSALQTFETWVKRVLC---QMMSPF*VH 145
A F + +R C M+S F H
Sbjct: 103 DEADSLFRSMPERDQCTWNSMVSGFAQH 130


>sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protein
At5g55740, chloroplastic OS=Arabidopsis thaliana
GN=CRR21 PE=2 SV=1
Length = 830

Score = 69.3 bits (168), Expect(2) = 5e-15
Identities = 39/100 (39%), Positives = 57/100 (57%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T+S+ A ++G +EE +H + + LD +G +LL+ YCKVGLI A +FD +
Sbjct: 276 TVSTCLSASANMGGVEEGKQSHAIAIVNGMELDNILGTSLLNFYCKVGLIEYAEMVFDRM 335

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFETWVKRVLCQMM 163
K+VVTWNL+I GY QGL A+ +CQ+M
Sbjct: 336 FEKDVVTWNLIISGYVQQGLVEDAI---------YMCQLM 366



Score = 30.4 bits (67), Expect(2) = 5e-15
Identities = 17/51 (33%), Positives = 25/51 (49%)
Frame = -3

Query: 169 DDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
D VT + + A G+ + C I ESD V A++++DMY K G
Sbjct: 374 DCVTLATLMSAAARTENLKLGKEVQCYCIRHSFESDIVLASTVMDMYAKCG 424



Score = 52.4 bits (124), Expect = 1e-06
Identities = 22/56 (39%), Positives = 35/56 (62%)
Frame = -1

Query: 366 DVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
D+ + ++DMY K G IV+A K+FD K+++ WN ++ YA GL+ AL+ F
Sbjct: 409 DIVLASTVMDMYAKCGSIVDAKKVFDSTVEKDLILWNTLLAAYAESGLSGEALRLF 464



Score = 50.4 bits (119), Expect = 4e-06
Identities = 23/61 (37%), Positives = 37/61 (60%)
Frame = -1

Query: 363 VSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTFETWVK 184
V V +L DMY K G++ +A+K+FD +P++N V WN ++ GY G A++ F K
Sbjct: 208 VFVASSLADMYGKCGVLDDASKVFDEIPDRNAVAWNALMVGYVQNGKNEEAIRLFSDMRK 267

Query: 183 R 181
+
Sbjct: 268 Q 268



Score = 34.3 bits (77), Expect(2) = 8e-04
Identities = 21/64 (32%), Positives = 31/64 (48%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M + + PD+ + +ACG L + GR +H V+ E A+SL DMY K G
Sbjct: 164 MLENEIFPDNFVVPNVCKACGALKWSRFGRGVHGYVVKSGLEDCVFVASSLADMYGKCGV 223

Query: 13 QDSS 2
D +
Sbjct: 224 LDDA 227



Score = 27.3 bits (59), Expect(2) = 8e-04
Identities = 17/49 (34%), Positives = 22/49 (44%)
Frame = -1

Query: 345 LLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
L+ Y K + A LF L +NV +W +IG GL AL F
Sbjct: 113 LVIFYAKCDALEIAEVLFSKLRVRNVFSWAAIIGVKCRIGLCEGALMGF 161



Score = 31.6 bits (70), Expect(2) = 0.037
Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 1/92 (1%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAH-FVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFD 289
F+++ AC + + H ++ + VS+ +L+DMY K G I +A K+F
Sbjct: 547 FSITVALSACAHLASLHIGRTIHGYIIRNLQHSSLVSIETSLVDMYAKCGDINKAEKVFG 606

Query: 288 LLPNKNVVTWNLMIGGYAHQGLALSALQTFET 193
+ N MI YA G A+ + +
Sbjct: 607 SKLYSELPLSNAMISAYALYGNLKEAIALYRS 638



Score = 24.3 bits (51), Expect(2) = 0.037
Identities = 11/36 (30%), Positives = 18/36 (50%)
Frame = -3

Query: 181 GLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRR 74
GL PD++T + L AC G + I ++ +R
Sbjct: 643 GLKPDNITITNVLSACNHAGDINQAIEIFTDIVSKR 678



Score = 35.8 bits (81), Expect = 0.093
Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMR-RHESDTVFANSLVDMYIK*G 17
M + GL P+ + AL AC L GR IH +I +H S SLVDMY K G
Sbjct: 537 MQESGLRPNAFSITVALSACAHLASLHIGRTIHGYIIRNLQHSSLVSIETSLVDMYAKCG 596


>sp|Q9ZUT4|PP192_ARATH Pentatricopeptide repeat-containing protein
At2g37320 OS=Arabidopsis thaliana GN=PCMP-E50 PE=2 SV=1
Length = 500

Score = 70.5 bits (171), Expect(2) = 1e-14
Identities = 33/90 (36%), Positives = 53/90 (58%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
+T +++ AC G + + H TL + + ++L+ MYCK G + +A ++FD
Sbjct: 222 YTFTALLSACTGSGALGQGRSVHCQTLHMGLKSYLHISNSLISMYCKCGDLKDAFRIFDQ 281

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
NK+VV+WN MI GYA GLA+ A++ FE
Sbjct: 282 FSNKDVVSWNSMIAGYAQHGLAMQAIELFE 311



Score = 28.1 bits (61), Expect(2) = 1e-14
Identities = 12/30 (40%), Positives = 17/30 (56%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGR 104
M + G PD +T+L L +C G+ EGR
Sbjct: 314 MPKSGTKPDAITYLGVLSSCRHAGLVKEGR 343



Score = 43.5 bits (101), Expect(2) = 9e-11
Identities = 24/79 (30%), Positives = 42/79 (53%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
+ LSS ++C + H + L+ DV +G +L+ +Y G + A K+F+
Sbjct: 121 YGLSSAVRSCGLNRDFRTGSGFHCLALKGGFISDVYLGSSLVVLYRDSGEVENAYKVFEE 180

Query: 285 LPNKNVVTWNLMIGGYAHQ 229
+P +NVV+W MI G+A +
Sbjct: 181 MPERNVVSWTAMISGFAQE 199



Score = 42.0 bits (97), Expect(2) = 9e-11
Identities = 21/52 (40%), Positives = 29/52 (55%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
P+D TF + L AC G +GR +HCQ + +S +NSL+ MY K G
Sbjct: 219 PNDYTFTALLSACTGSGALGQGRSVHCQTLHMGLKSYLHISNSLISMYCKCG 270


>sp|Q9LJR6|PP253_ARATH Putative pentatricopeptide repeat-containing
protein At3g25060, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E96 PE=3 SV=1
Length = 601

Score = 51.2 bits (121), Expect(2) = 2e-14
Identities = 29/64 (45%), Positives = 36/64 (56%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M G PD VT + L AC +G GRL+HC I++RH D V A +L+DMY K G
Sbjct: 309 MQSLGFQPDLVTLVGVLVACSQVGSLKTGRLVHC-YILKRHVLDRVTATALMDMYSKCGA 367

Query: 13 QDSS 2
SS
Sbjct: 368 LSSS 371



Score = 47.0 bits (110), Expect(2) = 2e-14
Identities = 26/82 (31%), Positives = 43/82 (52%)
Frame = -1

Query: 450 IAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKN 271
+ +A D+G+ + H ++V V +L+DMY KVG I A+++F + K
Sbjct: 223 LLQASGDLGDTKMGRSVHGYLYRTGLPMNVVVETSLVDMYAKVGFIEVASRVFSRMMFKT 282

Query: 270 VVTWNLMIGGYAHQGLALSALQ 205
V+W +I G+A GLA A +
Sbjct: 283 AVSWGSLISGFAQNGLANKAFE 304



Score = 43.5 bits (101), Expect(2) = 2e-08
Identities = 24/88 (27%), Positives = 45/88 (51%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T + KAC+ +E+ ++ DV V ++L++Y K G + EA LF +
Sbjct: 118 TFTMTIKACLSGLVLEKGEAVWCKAVDFGYKNDVFVCSSVLNLYMKCGKMDEAEVLFGKM 177

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
++V+ W M+ G+A G +L A++ +
Sbjct: 178 AKRDVICWTTMVTGFAQAGKSLKAVEFY 205



Score = 33.9 bits (76), Expect(2) = 2e-08
Identities = 22/59 (37%), Positives = 27/59 (45%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M +G D V L L+A G LG GR +H + + V SLVDMY K G
Sbjct: 208 MQNEGFGRDRVVMLGLLQASGDLGDTKMGRSVHGYLYRTGLPMNVVVETSLVDMYAKVG 266



Score = 48.5 bits (114), Expect = 1e-05
Identities = 28/88 (31%), Positives = 42/88 (47%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
TL + AC VG ++ L H L+ LD AL+DMY K G + + ++F+ +
Sbjct: 320 TLVGVLVACSQVGSLKTGRLVHCYILK-RHVLDRVTATALMDMYSKCGALSSSREIFEHV 378

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
K++V WN MI Y G + F
Sbjct: 379 GRKDLVCWNTMISCYGIHGNGQEVVSLF 406



Score = 35.8 bits (81), Expect = 0.093
Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALE-GRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQDSS 2
PD TF ++AC + G+ LE G + C+ + +++D +S++++Y+K G+ D +
Sbjct: 114 PDSSTFTMTIKAC-LSGLVLEKGEAVWCKAVDFGYKNDVFVCSSVLNLYMKCGKMDEA 170


>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein
At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1
Length = 741

Score = 59.3 bits (142), Expect(2) = 3e-14
Identities = 30/93 (32%), Positives = 50/93 (53%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T+ ++ AC G +E H + ++ + +AL+D+Y K G + A LF+ L
Sbjct: 268 TMVTVVSACAQSGSIELGRQVHLWIDDHGFGSNLKIVNALIDLYSKCGELETACGLFERL 327

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFETWVK 184
P K+V++WN +IGGY H L AL F+ ++
Sbjct: 328 PYKDVISWNTLIGGYTHMNLYKEALLLFQEMLR 360



Score = 38.1 bits (87), Expect(2) = 3e-14
Identities = 25/61 (40%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRH--ESDTVFANSLVDMYIK* 20
M + G P+DVT LS L AC LG GR IH + R + + SL+DMY K
Sbjct: 358 MLRSGETPNDVTMLSILPACAHLGAIDIGRWIHVYIDKRLKGVTNASSLRTSLIDMYAKC 417

Query: 19 G 17
G
Sbjct: 418 G 418



Score = 51.2 bits (121), Expect(2) = 2e-10
Identities = 28/61 (45%), Positives = 35/61 (57%)
Frame = -1

Query: 366 DVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTFETWV 187
DV AL+ Y G I A KLFD +P K+VV+WN MI GYA G AL+ F+ +
Sbjct: 199 DVVSYTALIKGYASRGYIENAQKLFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMM 258

Query: 186 K 184
K
Sbjct: 259 K 259



Score = 33.1 bits (74), Expect(2) = 2e-10
Identities = 17/65 (26%), Positives = 33/65 (50%)
Frame = -3

Query: 196 NMGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
+M + + PD+ T ++ + AC G GR +H + S+ N+L+D+Y K G
Sbjct: 256 DMMKTNVRPDESTMVTVVSACAQSGSIELGRQVHLWIDDHGFGSNLKIVNALIDLYSKCG 315

Query: 16 RQDSS 2
+++
Sbjct: 316 ELETA 320



Score = 43.1 bits (100), Expect(2) = 1e-06
Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 5/93 (5%)
Frame = -1

Query: 462 TLSSIAKAC-----IDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANK 298
T+ SI AC ID+G ++ + N + S+ +L+DMY K G I A++
Sbjct: 369 TMLSILPACAHLGAIDIGRWIHVYIDKRLKGVTNAS---SLRTSLIDMYAKCGDIEAAHQ 425

Query: 297 LFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+F+ + +K++ +WN MI G+A G A ++ F
Sbjct: 426 VFNSILHKSLSSWNAMIFGFAMHGRADASFDLF 458



Score = 28.5 bits (62), Expect(2) = 1e-06
Identities = 14/32 (43%), Positives = 19/32 (59%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLI 98
M + G+ PDD+TF+ L AC G+ GR I
Sbjct: 461 MRKIGIQPDDITFVGLLSACSHSGMLDLGRHI 492



Score = 49.7 bits (117), Expect = 6e-06
Identities = 27/90 (30%), Positives = 50/90 (55%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
+T + K+C +E H L+ LD+ V +L+ MY + G + +A+K+FD
Sbjct: 135 YTFPFVLKSCAKSKAFKEGQQIHGHVLKLGCDLDLYVHTSLISMYVQNGRLEDAHKVFDK 194

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
P+++VV++ +I GYA +G +A + F+
Sbjct: 195 SPHRDVVSYTALIKGYASRGYIENAQKLFD 224



Score = 36.6 bits (83), Expect(2) = 0.001
Identities = 19/60 (31%), Positives = 31/60 (51%)
Frame = -3

Query: 181 GLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQDSS 2
GL+P+ TF L++C EG+ IH V+ + D SL+ MY++ GR + +
Sbjct: 129 GLLPNSYTFPFVLKSCAKSKAFKEGQQIHGHVLKLGCDLDLYVHTSLISMYVQNGRLEDA 188



Score = 24.6 bits (52), Expect(2) = 0.001
Identities = 11/36 (30%), Positives = 19/36 (52%)
Frame = -1

Query: 306 ANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
A +F + N++ WN M G+A +SAL+ +
Sbjct: 87 AISVFKTIQEPNLLIWNTMFRGHALSSDPVSALKLY 122


>sp|Q9SII7|PP159_ARATH Pentatricopeptide repeat-containing protein
At2g17210 OS=Arabidopsis thaliana GN=PCMP-E77 PE=2 SV=2
Length = 736

Score = 57.8 bits (138), Expect(2) = 3e-14
Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 1/90 (1%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDAL-DVSVGHALLDMYCKVGLIVEANKLFDL 286
T+ S+ AC ++ AH + + + A+ D+SVG +++D Y K G I A + FD
Sbjct: 449 TVISLLNACSVSADLRTSKWAHGIAIRRSLAINDISVGTSIVDAYAKCGAIEMARRTFDQ 508

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+ KN+++W ++I YA GL AL F+
Sbjct: 509 ITEKNIISWTVIISAYAINGLPDKALALFD 538



Score = 39.7 bits (91), Expect(2) = 3e-14
Identities = 21/64 (32%), Positives = 35/64 (54%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M QKG P+ VT+L+AL AC G+ +G +I ++ H+ + +VDM + G
Sbjct: 540 MKQKGYTPNAVTYLAALSACNHGGLVKKGLMIFKSMVEEDHKPSLQHYSCIVDMLSRAGE 599

Query: 13 QDSS 2
D++
Sbjct: 600 IDTA 603



Score = 48.5 bits (114), Expect(2) = 4e-11
Identities = 28/97 (28%), Positives = 52/97 (53%), Gaps = 1/97 (1%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECN-DALDVSVGHALLDMYCKVGLIVEANKLFDL 286
T++S+ KAC + +++ H ++ D DV V ++L+DMY K + A ++FD
Sbjct: 249 TVTSVLKACTVMEDIDVGRSVHGFSIRRGFDLADVFVCNSLIDMYSKGFDVDSAFRVFDE 308

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWVKRVL 175
+N+V+WN ++ G+ H AL+ F V+ +
Sbjct: 309 TTCRNIVSWNSILAGFVHNQRYDEALEMFHLMVQEAV 345



Score = 38.1 bits (87), Expect(2) = 4e-11
Identities = 21/55 (38%), Positives = 31/55 (56%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMY 29
M Q+ + D+VT +S LR C L + IH +I R +ES+ V +SL+D Y
Sbjct: 340 MVQEAVEVDEVTVVSLLRVCKFFEQPLPCKSIHGVIIRRGYESNEVALSSLIDAY 394



Score = 36.2 bits (82), Expect(2) = 1e-05
Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFA-NSLVDMYIK 23
PD VT S L+AC V+ GR +H I R + VF NSL+DMY K
Sbjct: 245 PDCVTVTSVLKACTVMEDIDVGRSVHGFSIRRGFDLADVFVCNSLIDMYSK 295



Score = 31.6 bits (70), Expect(2) = 1e-05
Identities = 17/58 (29%), Positives = 32/58 (55%)
Frame = -1

Query: 360 SVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTFETWV 187
SV +++L MY + A KLFD + ++V++W+++I Y + L+ F+ V
Sbjct: 182 SVQNSILCMYADSDSL-SARKLFDEMSERDVISWSVVIRSYVQSKEPVVGLKLFKEMV 238



Score = 36.6 bits (83), Expect = 0.056
Identities = 17/55 (30%), Positives = 30/55 (54%)
Frame = -1

Query: 363 VSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
VSVG+++ D Y K G + + FD + +++ V+WN+++ G G L F
Sbjct: 82 VSVGNSIADFYMKCGDLCSGLREFDCMNSRDSVSWNVIVFGLLDYGFEEEGLWWF 136



Score = 36.6 bits (83), Expect = 0.056
Identities = 23/88 (26%), Positives = 40/88 (45%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T+ S+ + C + C H V + + +L+D Y L+ +A + D +
Sbjct: 351 TVVSLLRVCKFFEQPLPCKSIHGVIIRRGYESNEVALSSLIDAYTSCSLVDDAGTVLDSM 410

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
K+VV+ + MI G AH G + A+ F
Sbjct: 411 TYKDVVSCSTMISGLAHAGRSDEAISIF 438



Score = 33.1 bits (74), Expect = 0.60
Identities = 17/51 (33%), Positives = 23/51 (45%)
Frame = -3

Query: 169 DDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
D F +AC L +GR I ++ R ES NS+ D Y+K G
Sbjct: 46 DPFVFPIVFKACAKLSWLFQGRCIQASLLKRGFESFVSVGNSIADFYMKCG 96


>sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protein
At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1
Length = 596

Score = 53.9 bits (128), Expect(2) = 3e-14
Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDA-LDVSVGHALLDMYCKVGLIVEANKLFDL 286
T+ S+ KA V ++ H + LE DV +G +L+DMY K +A K+FD
Sbjct: 206 TVVSVLKAAGKVEDVRFGRSVHGLYLETGRVKCDVFIGSSLVDMYGKCSCYDDAQKVFDE 265

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWVK 184
+P++NVVTW +I GY + FE +K
Sbjct: 266 MPSRNVVTWTALIAGYVQSRCFDKGMLVFEEMLK 299



Score = 43.5 bits (101), Expect(2) = 3e-14
Identities = 20/59 (33%), Positives = 32/59 (54%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M + + P++ T S L AC +G GR +HC +I E +T +L+D+Y+K G
Sbjct: 297 MLKSDVAPNEKTLSSVLSACAHVGALHRGRRVHCYMIKNSIEINTTAGTTLIDLYVKCG 355



Score = 63.2 bits (152), Expect(2) = 5e-12
Identities = 33/90 (36%), Positives = 47/90 (52%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
TLSS+ AC VG + H ++ + ++ + G L+D+Y K G + EA +F+ L
Sbjct: 308 TLSSVLSACAHVGALHRGRRVHCYMIKNSIEINTTAGTTLIDLYVKCGCLEEAILVFERL 367

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFET 193
KNV TW MI G+A G A A F T
Sbjct: 368 HEKNVYTWTAMINGFAAHGYARDAFDLFYT 397



Score = 26.6 bits (57), Expect(2) = 5e-12
Identities = 11/23 (47%), Positives = 16/23 (69%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGR 104
P++VTF++ L AC G+ EGR
Sbjct: 405 PNEVTFMAVLSACAHGGLVEEGR 427



Score = 42.4 bits (98), Expect = 0.001
Identities = 26/70 (37%), Positives = 36/70 (51%)
Frame = -1

Query: 408 FLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQ 229
F AH V + D V ++L+ Y GL A++LFD +K+VVTW MI G+
Sbjct: 125 FHAHIVKFGLDS--DPFVRNSLISGYSSSGLFDFASRLFDGAEDKDVVTWTAMIDGFVRN 182

Query: 228 GLALSALQTF 199
G A A+ F
Sbjct: 183 GSASEAMVYF 192


tr_hit_id A9T8E9
Definition tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 89
Score (bit) 64.7
E-value 3.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914880|Adiantum capillus-veneris mRNA, clone:
YMU001_000063_H07.
(465 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 65 3e-17
tr|Q0IZR0|Q0IZR0_ORYSJ Os09g0555400 protein OS=Oryza sativa subs... 64 3e-17
tr|A2Z3X5|A2Z3X5_ORYSI Putative uncharacterized protein OS=Oryza... 64 3e-17
tr|A7QUQ9|A7QUQ9_VITVI Chromosome chr1 scaffold_180, whole genom... 68 1e-16
tr|A5AMS4|A5AMS4_VITVI Putative uncharacterized protein OS=Vitis... 64 3e-16
tr|A7NXD6|A7NXD6_VITVI Chromosome chr5 scaffold_2, whole genome ... 64 3e-16
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 66 4e-16
tr|A5BKU6|A5BKU6_VITVI Putative uncharacterized protein OS=Vitis... 65 4e-16
tr|A7PSG6|A7PSG6_VITVI Chromosome chr6 scaffold_28, whole genome... 65 4e-16
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 64 4e-16
tr|A7QN82|A7QN82_VITVI Chromosome undetermined scaffold_131, who... 59 6e-16
tr|Q7XV62|Q7XV62_ORYSJ OSJNBa0006B20.5 protein (Putative unchara... 60 7e-16
tr|B8AU15|B8AU15_ORYSI Putative uncharacterized protein OS=Oryza... 60 7e-16
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 63 1e-15
tr|B4FZF5|B4FZF5_MAIZE Putative uncharacterized protein OS=Zea m... 64 1e-15
tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 62 1e-15
tr|A5C1S9|A5C1S9_VITVI Putative uncharacterized protein OS=Vitis... 62 2e-15
tr|A3BS46|A3BS46_ORYSJ Putative uncharacterized protein OS=Oryza... 57 2e-15
tr|Q6Z0F9|Q6Z0F9_ORYSJ Os08g0340900 protein OS=Oryza sativa subs... 57 2e-15
tr|A7PPB6|A7PPB6_VITVI Chromosome chr8 scaffold_23, whole genome... 62 2e-15
tr|B8B9V5|B8B9V5_ORYSI Putative uncharacterized protein OS=Oryza... 57 2e-15
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 61 5e-15
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 61 5e-15
tr|A7P8G3|A7P8G3_VITVI Chromosome chr3 scaffold_8, whole genome ... 56 5e-15
tr|Q0DF57|Q0DF57_ORYSJ Os06g0114300 protein OS=Oryza sativa subs... 53 6e-15
tr|A5BMC7|A5BMC7_VITVI Putative uncharacterized protein OS=Vitis... 60 6e-15
tr|A7PQZ4|A7PQZ4_VITVI Chromosome chr6 scaffold_25, whole genome... 60 6e-15
tr|A7PWD6|A7PWD6_VITVI Chromosome chr8 scaffold_34, whole genome... 59 6e-15
tr|B8B1L4|B8B1L4_ORYSI Putative uncharacterized protein OS=Oryza... 53 6e-15
tr|A2XC93|A2XC93_ORYSI Putative uncharacterized protein OS=Oryza... 67 8e-15

>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 64.7 bits (156), Expect(2) = 3e-17
Identities = 32/89 (35%), Positives = 50/89 (56%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T+ S +C G +E HF ++ DV V + +L+MY K G I EA ++FD +
Sbjct: 128 TIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDKM 187

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
K+VV+W + IGGYA G + +A + F+
Sbjct: 188 EKKSVVSWTITIGGYADCGRSETAFEIFQ 216



Score = 46.6 bits (109), Expect(2) = 3e-17
Identities = 22/59 (37%), Positives = 34/59 (57%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M Q+G+VP+ +T++S L A G+ +H +++ HESDT +LV MY K G
Sbjct: 218 MEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMYAKCG 276



Score = 58.9 bits (141), Expect(2) = 4e-13
Identities = 31/89 (34%), Positives = 48/89 (53%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T +SI AC +E H +E A D VG+ L++MY G + +A ++FD +
Sbjct: 431 TYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRM 490

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+++V +N MIGGYA L AL+ F+
Sbjct: 491 IQRDIVAYNAMIGGYAAHNLGKEALKLFD 519



Score = 38.5 bits (88), Expect(2) = 4e-13
Identities = 23/57 (40%), Positives = 29/57 (50%)
Frame = -3

Query: 187 QKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
++GL PD VT+++ L AC G R IH V SDT N+LV Y K G
Sbjct: 523 EEGLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCG 579



Score = 59.7 bits (143), Expect(2) = 7e-12
Identities = 31/89 (34%), Positives = 48/89 (53%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T ++ AC + G +E H + + D SVG+AL+ Y K G +A+ +F+ +
Sbjct: 532 TYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDASIVFEKM 591

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+NV++WN +IGG A G ALQ FE
Sbjct: 592 TKRNVISWNAIIGGSAQHGRGQDALQLFE 620



Score = 33.5 bits (75), Expect(2) = 7e-12
Identities = 16/36 (44%), Positives = 21/36 (58%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQV 86
M +G+ PD VTF+S L AC G+ EGR C +
Sbjct: 622 MKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM 657



Score = 51.2 bits (121), Expect(2) = 6e-11
Identities = 25/85 (29%), Positives = 42/85 (49%)
Frame = -1

Query: 450 IAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKN 271
+ AC++ + H + D+ V +AL+ MY + G I +A +FD + K+
Sbjct: 334 LLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDARLVFDKMVRKD 393

Query: 270 VVTWNLMIGGYAHQGLALSALQTFE 196
V++W MIGG A G AL ++
Sbjct: 394 VISWTAMIGGLAKSGFGAEALTVYQ 418



Score = 38.9 bits (89), Expect(2) = 6e-11
Identities = 22/55 (40%), Positives = 29/55 (52%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMY 29
M Q G+ P+ VT+ S L AC GR IH QV+ +D N+LV+MY
Sbjct: 420 MQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMY 474



Score = 47.4 bits (111), Expect(2) = 2e-08
Identities = 22/58 (37%), Positives = 32/58 (55%)
Frame = -1

Query: 399 HFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAHQG 226
H L D +VG AL+ MY K G + ++F+ L N++++ WN MIGG A G
Sbjct: 250 HSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGG 307



Score = 34.3 bits (77), Expect(2) = 2e-08
Identities = 18/59 (30%), Positives = 31/59 (52%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M ++G++P+ +T++ L AC G+ IH +V SD N+L+ MY + G
Sbjct: 319 MQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCG 377



Score = 37.4 bits (85), Expect = 0.38
Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 2/82 (2%)
Frame = -1

Query: 444 KACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLP--NKN 271
K CI+V ++ H ++ D +AL++MY + G I EA +++ L +
Sbjct: 31 KRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALINMYIQCGSIEEARQVWKKLSYMERT 90

Query: 270 VVTWNLMIGGYAHQGLALSALQ 205
V +WN M+ GY G AL+
Sbjct: 91 VHSWNAMVVGYIQYGYIEKALK 112


>tr|Q0IZR0|Q0IZR0_ORYSJ Os09g0555400 protein OS=Oryza sativa subsp.
japonica GN=Os09g0555400 PE=4 SV=1
Length = 644

Score = 64.3 bits (155), Expect(2) = 3e-17
Identities = 34/90 (37%), Positives = 47/90 (52%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FTL + KAC V E + H V ++ V VG+ALL Y G + ++ + FD
Sbjct: 111 FTLPFLLKACARVQAWEHVMVTHGVVVKLGFVGQVFVGNALLHSYASAGSLGDSRRFFDE 170

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+ ++NVV+WN MI GYA G A FE
Sbjct: 171 MVDRNVVSWNSMINGYAQAGNTREACSLFE 200



Score = 47.0 bits (110), Expect(2) = 3e-17
Identities = 24/59 (40%), Positives = 36/59 (61%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M ++GL+ D+ T +S L AC G G+L+H +++R D + AN+LVDMY K G
Sbjct: 202 MRRQGLLADEFTLVSLLFACSAEGNLEFGKLVHSHLLVRGCRIDLILANALVDMYGKCG 260



Score = 53.5 bits (127), Expect(2) = 4e-14
Identities = 32/90 (35%), Positives = 48/90 (53%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FTL S+ AC G +E L H L +D+ + +AL+DMY K G ++ A+ FD+
Sbjct: 212 FTLVSLLFACSAEGNLEFGKLVHSHLLVRGCRIDLILANALVDMYGKCGDLLMAHTCFDM 271

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+P KN V+W M+ A + +A FE
Sbjct: 272 MPFKNAVSWTSMLCALAKRASIDAARDWFE 301



Score = 47.4 bits (111), Expect(2) = 4e-14
Identities = 23/60 (38%), Positives = 33/60 (55%)
Frame = -3

Query: 181 GLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQDSS 2
GL PD+ T + L ACG LG G++IH + H NSL+DMY + G+ D++
Sbjct: 338 GLAPDEFTLAAVLSACGQLGDLASGKMIHDCIRDNFHNPGVALFNSLLDMYARCGQVDTA 397



Score = 60.5 bits (145), Expect(2) = 5e-09
Identities = 32/93 (34%), Positives = 52/93 (55%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FTL+++ AC +G++ + H + V++ ++LLDMY + G + A LF
Sbjct: 344 FTLAAVLSACGQLGDLASGKMIHDCIRDNFHNPGVALFNSLLDMYARCGQVDTAISLFSE 403

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWV 187
+P+KNV++WN +IG A G A AL F + V
Sbjct: 404 MPSKNVISWNAIIGALAMHGRAQDALMFFRSMV 436



Score = 23.1 bits (48), Expect(2) = 5e-09
Identities = 9/23 (39%), Positives = 15/23 (65%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGR 104
PD++TF++ L AC G+ G+
Sbjct: 442 PDEITFVALLSACNHGGLLEAGQ 464


>tr|A2Z3X5|A2Z3X5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_32340 PE=4 SV=1
Length = 644

Score = 64.3 bits (155), Expect(2) = 3e-17
Identities = 34/90 (37%), Positives = 47/90 (52%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FTL + KAC V E + H V ++ V VG+ALL Y G + ++ + FD
Sbjct: 111 FTLPFLLKACARVQAWEHVMVTHGVVVKLGFVGQVFVGNALLHSYASAGSLGDSRRFFDE 170

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+ ++NVV+WN MI GYA G A FE
Sbjct: 171 MVDRNVVSWNSMINGYAQAGNTREACSLFE 200



Score = 47.0 bits (110), Expect(2) = 3e-17
Identities = 24/59 (40%), Positives = 36/59 (61%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M ++GL+ D+ T +S L AC G G+L+H +++R D + AN+LVDMY K G
Sbjct: 202 MRRQGLLADEFTLVSLLFACSAEGNLEFGKLVHSHLLVRGCRIDLILANALVDMYGKCG 260



Score = 53.5 bits (127), Expect(2) = 4e-14
Identities = 32/90 (35%), Positives = 48/90 (53%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FTL S+ AC G +E L H L +D+ + +AL+DMY K G ++ A+ FD+
Sbjct: 212 FTLVSLLFACSAEGNLEFGKLVHSHLLVRGCRIDLILANALVDMYGKCGDLLMAHTCFDM 271

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+P KN V+W M+ A + +A FE
Sbjct: 272 MPFKNAVSWTSMLCALAKRASIDAARDWFE 301



Score = 47.4 bits (111), Expect(2) = 4e-14
Identities = 23/60 (38%), Positives = 33/60 (55%)
Frame = -3

Query: 181 GLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQDSS 2
GL PD+ T + L ACG LG G++IH + H NSL+DMY + G+ D++
Sbjct: 338 GLAPDEFTLAAVLSACGQLGDLASGKMIHDCIRDNFHNPGVALFNSLLDMYARCGQVDTA 397



Score = 60.5 bits (145), Expect(2) = 5e-09
Identities = 32/93 (34%), Positives = 52/93 (55%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FTL+++ AC +G++ + H + V++ ++LLDMY + G + A LF
Sbjct: 344 FTLAAVLSACGQLGDLASGKMIHDCIRDNFHNPGVALFNSLLDMYARCGQVDTAISLFSE 403

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWV 187
+P+KNV++WN +IG A G A AL F + V
Sbjct: 404 MPSKNVISWNAIIGALAMHGRAQDALMFFRSMV 436



Score = 23.1 bits (48), Expect(2) = 5e-09
Identities = 9/23 (39%), Positives = 15/23 (65%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGR 104
PD++TF++ L AC G+ G+
Sbjct: 442 PDEITFVALLSACNHGGLLEAGQ 464


>tr|A7QUQ9|A7QUQ9_VITVI Chromosome chr1 scaffold_180, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00006945001
PE=4 SV=1
Length = 828

Score = 62.0 bits (149), Expect(2) = 1e-16
Identities = 32/89 (35%), Positives = 50/89 (56%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT +S+ KAC+ + + H L+ LD+ VG ALLD+Y K G I +A + F+
Sbjct: 255 FTFASVFKACLGLEAFDVGKSVHGCALKSRYELDLYVGVALLDLYTKSGDIDDARRAFEE 314

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+P K+V+ W+ MI YA + A++ F
Sbjct: 315 IPKKDVIPWSFMIARYAQSDQSKEAVEMF 343



Score = 47.4 bits (111), Expect(2) = 1e-16
Identities = 25/64 (39%), Positives = 36/64 (56%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M Q ++P+ TF S L+AC + G IHC VI SD +N+L+D+Y K GR
Sbjct: 346 MRQALVLPNQFTFASVLQACATMEGLNLGNQIHCHVIKIGLHSDVFVSNALMDVYAKCGR 405

Query: 13 QDSS 2
++S
Sbjct: 406 MENS 409



Score = 50.8 bits (120), Expect(2) = 5e-12
Identities = 29/89 (32%), Positives = 47/89 (52%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT +S+ +AC + + H ++ DV V +AL+D+Y K G + + +LF
Sbjct: 356 FTFASVLQACATMEGLNLGNQIHCHVIKIGLHSDVFVSNALMDVYAKCGRMENSMELFAE 415

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
P++N VTWN +I G+ G AL+ F
Sbjct: 416 SPHRNDVTWNTVIVGHVQLGDGEKALRLF 444



Score = 42.7 bits (99), Expect(2) = 5e-12
Identities = 23/60 (38%), Positives = 31/60 (51%)
Frame = -3

Query: 196 NMGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
NM + + +VT+ SALRAC L G IH + + D V N+L+DMY K G
Sbjct: 446 NMLEYRVQATEVTYSSALRACASLAALEPGLQIHSLTVKTTFDKDIVVTNALIDMYAKCG 505



Score = 68.2 bits (165), Expect(2) = 2e-11
Identities = 34/89 (38%), Positives = 52/89 (58%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T SS +AC + +E H +T++ D+ V +AL+DMY K G I +A +FDL+
Sbjct: 458 TYSSALRACASLAALEPGLQIHSLTVKTTFDKDIVVTNALIDMYAKCGSIKDARLVFDLM 517

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
++ V+WN MI GY+ GL AL+ F+
Sbjct: 518 NKQDEVSWNAMISGYSMHGLGREALRIFD 546



Score = 23.9 bits (50), Expect(2) = 2e-11
Identities = 11/37 (29%), Positives = 19/37 (51%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVI 83
M + + PD +TF+ L AC G+ +G+ +I
Sbjct: 548 MQETEVKPDKLTFVGVLSACANAGLLDQGQAYFTSMI 584



Score = 47.0 bits (110), Expect(2) = 9e-06
Identities = 26/80 (32%), Positives = 41/80 (51%)
Frame = -1

Query: 438 CIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTW 259
CI E H L+ LD+ + LL+MY K + +A+KLFD +P +N +++
Sbjct: 62 CIQKDEPSRGKGLHCEILKRGGCLDLFAWNILLNMYVKSDFLCDASKLFDEMPERNTISF 121

Query: 258 NLMIGGYAHQGLALSALQTF 199
+I GYA L A++ F
Sbjct: 122 VTLIQGYAESVRFLEAIELF 141



Score = 25.4 bits (54), Expect(2) = 9e-06
Identities = 15/43 (34%), Positives = 19/43 (44%)
Frame = -3

Query: 136 CGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQD 8
CG LG IH + HES+ +L+D Y GR D
Sbjct: 168 CGELGWG-----IHACIFKLGHESNAFVGTALIDAYSVCGRVD 205



Score = 35.0 bits (79), Expect(2) = 4e-05
Identities = 23/89 (25%), Positives = 40/89 (44%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
F ++I K + E + H + + VG AL+D Y G + A ++FD
Sbjct: 154 FVFTTILKLLVSTDCGELGWGIHACIFKLGHESNAFVGTALIDAYSVCGRVDVAREVFDG 213

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+ K++V+W M+ +A AL+ F
Sbjct: 214 ILYKDMVSWTGMVTCFAENDCFKEALKLF 242



Score = 35.0 bits (79), Expect(2) = 4e-05
Identities = 20/64 (31%), Positives = 31/64 (48%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M G P++ TF S +AC L G+ +H + R+E D +L+D+Y K G
Sbjct: 245 MRMVGFKPNNFTFASVFKACLGLEAFDVGKSVHGCALKSRYELDLYVGVALLDLYTKSGD 304

Query: 13 QDSS 2
D +
Sbjct: 305 IDDA 308


>tr|A5AMS4|A5AMS4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018656 PE=4 SV=1
Length = 787

Score = 60.8 bits (146), Expect(2) = 3e-16
Identities = 32/89 (35%), Positives = 49/89 (55%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT +S+ KAC+ + + H L+ LD+ VG ALLD+Y K G I +A F+
Sbjct: 241 FTFASVFKACLGLEAFDVGKSVHGCALKSRYELDLYVGVALLDLYTKSGDIDDARXAFEE 300

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+P K+V+ W+ MI YA + A++ F
Sbjct: 301 IPKKDVIPWSFMIARYAQSDQSKEAVEMF 329



Score = 47.4 bits (111), Expect(2) = 3e-16
Identities = 25/64 (39%), Positives = 36/64 (56%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M Q ++P+ TF S L+AC + G IHC VI SD +N+L+D+Y K GR
Sbjct: 332 MRQALVLPNQFTFASVLQACATMEGLNLGNQIHCHVIKIGLHSDVFVSNALMDVYAKCGR 391

Query: 13 QDSS 2
++S
Sbjct: 392 MENS 395



Score = 45.4 bits (106), Expect(2) = 2e-10
Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT +S+ +AC + + H ++ DV V +AL+D+Y K G + + LF
Sbjct: 342 FTFASVLQACATMEGLNLGNQIHCHVIKIGLHSDVFVSNALMDVYAKCGRMENSMXLFAE 401

Query: 285 LPNKNVVT-WNLMIGGYAHQGLALSALQTF 199
P++N VT WN +I G+ G AL+ F
Sbjct: 402 SPHRNDVTPWNTVIVGHVQLGDGEKALRLF 431



Score = 42.7 bits (99), Expect(2) = 2e-10
Identities = 23/60 (38%), Positives = 31/60 (51%)
Frame = -3

Query: 196 NMGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
NM + + +VT+ SALRAC L G IH + + D V N+L+DMY K G
Sbjct: 433 NMLEYRVQATEVTYSSALRACASLAALEPGLQIHSLTVKTTFDKDIVVTNALIDMYAKCG 492



Score = 64.3 bits (155), Expect = 3e-09
Identities = 32/81 (39%), Positives = 48/81 (59%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T SS +AC + +E H +T++ D+ V +AL+DMY K G I +A +FDL+
Sbjct: 445 TYSSALRACASLAALEPGLQIHSLTVKTTFDKDIVVTNALIDMYAKCGSIKDARLVFDLM 504

Query: 282 PNKNVVTWNLMIGGYAHQGLA 220
++ V+WN MI GY+ GLA
Sbjct: 505 NKQDEVSWNAMISGYSMHGLA 525



Score = 47.0 bits (110), Expect(2) = 9e-06
Identities = 26/80 (32%), Positives = 41/80 (51%)
Frame = -1

Query: 438 CIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTW 259
CI E H L+ LD+ + LL+MY K + +A+KLFD +P +N +++
Sbjct: 48 CIQKDEPSRGKGLHCEILKRGGCLDLFAWNILLNMYVKSDFLCDASKLFDEMPERNTISF 107

Query: 258 NLMIGGYAHQGLALSALQTF 199
+I GYA L A++ F
Sbjct: 108 VTLIQGYAESVRFLEAIELF 127



Score = 25.4 bits (54), Expect(2) = 9e-06
Identities = 15/43 (34%), Positives = 19/43 (44%)
Frame = -3

Query: 136 CGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQD 8
CG LG IH + HES+ +L+D Y GR D
Sbjct: 154 CGELGWG-----IHACIFKLGHESNAFVGTALIDAYSVCGRVD 191



Score = 35.4 bits (80), Expect(2) = 3e-05
Identities = 23/89 (25%), Positives = 41/89 (46%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
F ++I K + + E + H + + VG AL+D Y G + A ++FD
Sbjct: 140 FVFTTILKLLVSMDCGELGWGIHACIFKLGHESNAFVGTALIDAYSVCGRVDVAREVFDG 199

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+ K++V+W M+ +A AL+ F
Sbjct: 200 ILYKDMVSWTGMVTCFAENDCFKEALKLF 228



Score = 35.0 bits (79), Expect(2) = 3e-05
Identities = 20/64 (31%), Positives = 31/64 (48%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M G P++ TF S +AC L G+ +H + R+E D +L+D+Y K G
Sbjct: 231 MRMVGFKPNNFTFASVFKACLGLEAFDVGKSVHGCALKSRYELDLYVGVALLDLYTKSGD 290

Query: 13 QDSS 2
D +
Sbjct: 291 IDDA 294


>tr|A7NXD6|A7NXD6_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020291001
PE=4 SV=1
Length = 705

Score = 61.6 bits (148), Expect(2) = 3e-16
Identities = 32/90 (35%), Positives = 51/90 (56%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT S+ KAC +G +E H + ++ VG+A +DMY K G I A ++F+
Sbjct: 126 FTFSTSLKACGALGVVENGMQIHGMCVKSGFEWVSVVGNATIDMYSKCGRIGMAEQVFNK 185

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFE 196
+P +N+V+WN MI G+ H+G +L F+
Sbjct: 186 MPFRNLVSWNAMIAGHTHEGNGRKSLVLFQ 215



Score = 46.2 bits (108), Expect(2) = 3e-16
Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESD--TVFANSLVDMYIK* 20
M +G VPD+ TF S L+ACG LG G IH +I R + A+++VD+Y K
Sbjct: 217 MQGQGEVPDEFTFTSTLKACGALGAIRGGTQIHASLITRGFPISIRNIIASAIVDLYAKC 276

Query: 19 G 17
G
Sbjct: 277 G 277



Score = 56.2 bits (134), Expect(2) = 3e-10
Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVS--VGHALLDMYCKVGLIVEANKLF 292
FT +S KAC +G + H + + + + A++D+Y K G + EA K+F
Sbjct: 227 FTFTSTLKACGALGAIRGGTQIHASLITRGFPISIRNIIASAIVDLYAKCGYLFEAQKVF 286

Query: 291 DLLPNKNVVTWNLMIGGYAHQGLALSALQTF 199
D + KN+++W+ +I G+A +G L A+ F
Sbjct: 287 DRIEQKNLISWSALIQGFAQEGNLLEAMDLF 317



Score = 31.2 bits (69), Expect(2) = 3e-10
Identities = 13/37 (35%), Positives = 22/37 (59%)
Frame = -3

Query: 127 LGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
L + +G+ +HC ++ D ANS++DMY+K G
Sbjct: 342 LALVEQGKQMHCYILKVPSGLDISVANSIIDMYLKCG 378



Score = 63.5 bits (153), Expect(2) = 2e-09
Identities = 33/89 (37%), Positives = 49/89 (55%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
F LS + D+ +E+ H L+ LD+SV ++++DMY K GL EA +LF
Sbjct: 330 FVLSIMMGVFADLALVEQGKQMHCYILKVPSGLDISVANSIIDMYLKCGLTEEAERLFSE 389

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+ +NVV+W +MI GY GL A+ F
Sbjct: 390 MQVRNVVSWTVMITGYGKHGLGEKAIHLF 418



Score = 21.2 bits (43), Expect(2) = 2e-09
Identities = 9/26 (34%), Positives = 15/26 (57%)
Frame = -3

Query: 181 GLVPDDVTFLSALRACGVLGVALEGR 104
G+ D+V +L+ L AC G+ E +
Sbjct: 425 GIELDEVAYLALLSACSHSGLIRESQ 450



Score = 50.8 bits (120), Expect = 3e-05
Identities = 25/60 (41%), Positives = 35/60 (58%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
MG G+ P++ TF ++L+ACG LGV G IH + E +V N+ +DMY K GR
Sbjct: 116 MGYSGVKPNEFTFSTSLKACGALGVVENGMQIHGMCVKSGFEWVSVVGNATIDMYSKCGR 175



Score = 43.9 bits (102), Expect = 0.004
Identities = 25/98 (25%), Positives = 46/98 (46%)
Frame = -1

Query: 459 LSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLP 280
L+ + + C G ++ H + D+ + + L+DMY K + A +FD +
Sbjct: 27 LAKLLRNCSKNGLFDQGLQVHAAAVNMGFGFDLIMNNDLIDMYGKCSRVDLACSVFDRML 86

Query: 279 NKNVVTWNLMIGGYAHQGLALSALQTFETWVKRVLCQM 166
+NVV+W ++ GY +G A +L +LC+M
Sbjct: 87 ERNVVSWTALMCGYLQEGNAKGSL--------ALLCEM 116


>tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2
SV=2
Length = 1106

Score = 63.2 bits (152), Expect(2) = 4e-16
Identities = 31/86 (36%), Positives = 49/86 (56%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T SSI K C ++E L LD VG+AL+ Y K G + +A ++FD +
Sbjct: 635 TFSSILKVCTSSACLDEGKKVIAYILNSGYELDTGVGNALISAYSKSGSMTDAREVFDKM 694

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQ 205
P++++V+WN +I GYA GL +A++
Sbjct: 695 PSRDIVSWNKIIAGYAQNGLGQTAVE 720



Score = 44.3 bits (103), Expect(2) = 4e-16
Identities = 19/61 (31%), Positives = 34/61 (55%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M ++ +VP+ +F+S L AC EG+ +H +++ R+ + D +L+ MY K G
Sbjct: 725 MQEQDVVPNKFSFVSLLNACSSFSALEEGKRVHAEIVKRKLQGDVRVGAALISMYAKCGS 784

Query: 13 Q 11
Q
Sbjct: 785 Q 785



Score = 65.9 bits (159), Expect(2) = 7e-13
Identities = 39/94 (41%), Positives = 48/94 (51%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
F+ S+ AC +EE H ++ DV VG AL+ MY K G EA ++FD
Sbjct: 735 FSFVSLLNACSSFSALEEGKRVHAEIVKRKLQGDVRVGAALISMYAKCGSQGEAQEVFDN 794

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWVK 184
+ KNVVTWN MI YA GLA AL F K
Sbjct: 795 IIEKNVVTWNAMINAYAQHGLASKALGFFNCMEK 828



Score = 30.8 bits (68), Expect(2) = 7e-13
Identities = 14/29 (48%), Positives = 18/29 (62%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEG 107
M ++G+ PD TF S L AC G+ LEG
Sbjct: 826 MEKEGIKPDGSTFTSILSACNHAGLVLEG 854



Score = 54.7 bits (130), Expect(2) = 9e-12
Identities = 27/78 (34%), Positives = 44/78 (56%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T SI AC +E L H E + DV +G+AL+ MY + G + +A +LF +
Sbjct: 332 TYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTM 391

Query: 282 PNKNVVTWNLMIGGYAHQ 229
P +++++WN +I GYA +
Sbjct: 392 PKRDLISWNAIIAGYARR 409



Score = 38.1 bits (87), Expect(2) = 9e-12
Identities = 20/59 (33%), Positives = 33/59 (55%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M +G+ P VTFL L AC +G++IH ++ +S+ AN+L++MY + G
Sbjct: 422 MQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYRRCG 480



Score = 50.1 bits (118), Expect(2) = 3e-11
Identities = 25/89 (28%), Positives = 47/89 (52%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T ++ + C + E H +E D+ + + L++MY K +++A+++F +
Sbjct: 29 TYVALLQNCTRKRLLPEAKRIHAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVFKEM 88

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
P ++V++WN +I YA QG A Q FE
Sbjct: 89 PRRDVISWNSLISCYAQQGFKKKAFQLFE 117



Score = 40.8 bits (94), Expect(2) = 3e-11
Identities = 21/59 (35%), Positives = 31/59 (52%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M G +P+ +T++S L AC G+ IH Q+I ++ D NSL+ MY K G
Sbjct: 119 MQNAGFIPNKITYISILTACYSPAELENGKKIHSQIIKAGYQRDPRVQNSLLSMYGKCG 177



Score = 43.5 bits (101), Expect(2) = 2e-07
Identities = 23/89 (25%), Positives = 45/89 (50%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T + AC + + + H L + + +AL++MY + G ++EA +F+
Sbjct: 433 TFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGT 492

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
++V++WN MI G+A G +A + F+
Sbjct: 493 QARDVISWNSMIAGHAQHGSYETAYKLFQ 521



Score = 34.7 bits (78), Expect(2) = 2e-07
Identities = 19/59 (32%), Positives = 30/59 (50%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M + L PD++TF S L C G+ IH ++ + D N+L++MYI+ G
Sbjct: 523 MQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMYIRCG 581



Score = 43.1 bits (100), Expect(2) = 3e-07
Identities = 27/88 (30%), Positives = 42/88 (47%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T SI AC E+E H ++ D V ++LL MY K G + A ++F +
Sbjct: 130 TYISILTACYSPAELENGKKIHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGI 189

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
++VV++N M+G YA + L F
Sbjct: 190 SPRDVVSYNTMLGLYAQKAYVKECLGLF 217



Score = 34.3 bits (77), Expect(2) = 3e-07
Identities = 20/64 (31%), Positives = 32/64 (50%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GR 14
M +G+ PD VT+++ L A + EG+ IH + SD +LV M ++ G
Sbjct: 220 MSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTMCVRCGD 279

Query: 13 QDSS 2
DS+
Sbjct: 280 VDSA 283



Score = 56.2 bits (134), Expect = 8e-07
Identities = 29/88 (32%), Positives = 50/88 (56%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T +S+ C + +E H E LDV++G+AL++MY + G + +A +F L
Sbjct: 534 TFASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSL 593

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
+++V++W MIGG A QG + A++ F
Sbjct: 594 QHRDVMSWTAMIGGCADQGEDMKAIELF 621



Score = 39.7 bits (91), Expect = 0.075
Identities = 20/59 (33%), Positives = 28/59 (47%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M G+ + T+LS L AC G+LIH + H SD N+L+ MY + G
Sbjct: 321 MRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCG 379


>tr|A5BKU6|A5BKU6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028907 PE=4 SV=1
Length = 948

Score = 64.7 bits (156), Expect(2) = 4e-16
Identities = 31/95 (32%), Positives = 55/95 (57%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
+T+SS+ +AC +G +EE + H + + DV V + LL MYCK +++ ++FD
Sbjct: 276 YTMSSVLRACGGLGSVEEGDIIHGLIEKIGIKKDVIVNNGLLSMYCKFNGLIDGRRIFDK 335

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWVKR 181
+ ++ V+WN MI GY+ GL +++ F V +
Sbjct: 336 MVLRDAVSWNTMICGYSQVGLYEESIKLFMEMVNQ 370



Score = 42.7 bits (99), Expect(2) = 4e-16
Identities = 22/52 (42%), Positives = 31/52 (59%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
PD +T S L+ACG LG G+ +H +I +E DT +N L++MY K G
Sbjct: 373 PDLLTITSILQACGHLGDLEFGKYVHDYMITSGYECDTTASNILINMYAKCG 424



Score = 59.3 bits (142), Expect(2) = 6e-15
Identities = 29/89 (32%), Positives = 49/89 (55%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
+T S+ AC + + E H L D+ +G+AL+DMYC+ + +A K+F+
Sbjct: 175 YTFPSVINACAGLLDFEMAKSIHDRVLXMGFGSDLYIGNALIDMYCRFNDLDKARKVFEE 234

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+P ++VV+WN +I GY G AL+ +
Sbjct: 235 MPLRDVVSWNSLISGYNANGYWNEALEIY 263



Score = 44.3 bits (103), Expect(2) = 6e-15
Identities = 23/53 (43%), Positives = 29/53 (54%)
Frame = -3

Query: 181 GLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK 23
G+VPD T S LRACG LG EG +IH + + D + N L+ MY K
Sbjct: 270 GVVPDSYTMSSVLRACGGLGSVEEGDIIHGLIEKIGIKKDVIVNNGLLSMYCK 322



Score = 48.1 bits (113), Expect(2) = 2e-10
Identities = 25/89 (28%), Positives = 47/89 (52%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T++SI +AC +G++E H + D + + L++MY K G ++ + ++F +
Sbjct: 377 TITSILQACGHLGDLEFGKYVHDYMITSGYECDTTASNILINMYAKCGNLLASQEVFSGM 436

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
K+ V+WN MI Y G A++ F+
Sbjct: 437 KCKDSVSWNSMINVYIQNGSFDEAMKLFK 465



Score = 40.0 bits (92), Expect(2) = 2e-10
Identities = 21/57 (36%), Positives = 29/57 (50%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQDSS 2
PD VT++ L LG G+ +HC + S+ V +N+LVDMY K G S
Sbjct: 473 PDSVTYVMLLSMSTQLGDLXLGKELHCDLAKMGFNSNIVVSNTLVDMYAKCGEMGDS 529



Score = 42.7 bits (99), Expect(2) = 4e-08
Identities = 25/72 (34%), Positives = 34/72 (47%)
Frame = -3

Query: 232 SRACIVSTTDI*NMGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVF 53
S C + I M +G+ PD T LS L C +L +G+ IH + ESD
Sbjct: 554 SEDCNLGLRMISRMRTEGVTPDMATMLSILPVCSLLAAKRQGKEIHGCIFKLGLESDVPV 613

Query: 52 ANSLVDMYIK*G 17
N L++MY K G
Sbjct: 614 GNVLIEMYSKCG 625



Score = 37.7 bits (86), Expect(2) = 4e-08
Identities = 14/45 (31%), Positives = 29/45 (64%)
Frame = -1

Query: 366 DVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAH 232
++ V + L+DMY K G + ++ K+F+ + ++++TWN +I H
Sbjct: 509 NIVVSNTLVDMYAKCGEMGDSLKVFENMKARDIITWNTIIASCVH 553



Score = 43.1 bits (100), Expect(2) = 4e-05
Identities = 25/88 (28%), Positives = 41/88 (46%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T+ SI C + + H + DV VG+ L++MY K G + + ++F L+
Sbjct: 578 TMLSILPVCSLLAAKRQGKEIHGCIFKLGLESDVPVGNVLIEMYSKCGSLRNSFQVFKLM 637

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
K+VVTW +I G A++ F
Sbjct: 638 KTKDVVTWTALISACGMYGEGKKAVRAF 665



Score = 26.9 bits (58), Expect(2) = 4e-05
Identities = 12/29 (41%), Positives = 17/29 (58%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEG 107
M G+VPD V F++ + AC G+ EG
Sbjct: 668 MEAAGIVPDHVAFVAIIFACSHSGLVEEG 696



Score = 34.3 bits (77), Expect(2) = 0.020
Identities = 19/52 (36%), Positives = 26/52 (50%)
Frame = -3

Query: 178 LVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK 23
L PD TF S + AC L + IH +V+ SD N+L+DMY +
Sbjct: 170 LQPDTYTFPSVINACAGLLDFEMAKSIHDRVLXMGFGSDLYIGNALIDMYCR 221



Score = 26.6 bits (57), Expect(2) = 0.020
Identities = 11/28 (39%), Positives = 14/28 (50%)
Frame = -1

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
P+ NV WN +I H GL AL +
Sbjct: 135 PSNNVYXWNSIIRALTHNGLFSEALSLY 162


>tr|A7PSG6|A7PSG6_VITVI Chromosome chr6 scaffold_28, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022909001
PE=4 SV=1
Length = 889

Score = 64.7 bits (156), Expect(2) = 4e-16
Identities = 31/95 (32%), Positives = 55/95 (57%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
+T+SS+ +AC +G +EE + H + + DV V + LL MYCK +++ ++FD
Sbjct: 217 YTMSSVLRACGGLGSVEEGDIIHGLIEKIGIKKDVIVNNGLLSMYCKFNGLIDGRRIFDK 276

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWVKR 181
+ ++ V+WN MI GY+ GL +++ F V +
Sbjct: 277 MVLRDAVSWNTMICGYSQVGLYEESIKLFMEMVNQ 311



Score = 42.7 bits (99), Expect(2) = 4e-16
Identities = 22/52 (42%), Positives = 31/52 (59%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
PD +T S L+ACG LG G+ +H +I +E DT +N L++MY K G
Sbjct: 314 PDLLTITSILQACGHLGDLEFGKYVHDYMITSGYECDTTASNILINMYAKCG 365



Score = 60.5 bits (145), Expect(2) = 3e-15
Identities = 29/89 (32%), Positives = 50/89 (56%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
+T S+ AC + + E H L+ D+ +G+AL+DMYC+ + +A K+F+
Sbjct: 116 YTFPSVINACAGLLDFEMAKSIHDRVLDMGFGSDLYIGNALIDMYCRFNDLDKARKVFEE 175

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTF 199
+P ++VV+WN +I GY G AL+ +
Sbjct: 176 MPLRDVVSWNSLISGYNANGYWNEALEIY 204



Score = 44.3 bits (103), Expect(2) = 3e-15
Identities = 23/53 (43%), Positives = 29/53 (54%)
Frame = -3

Query: 181 GLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK 23
G+VPD T S LRACG LG EG +IH + + D + N L+ MY K
Sbjct: 211 GVVPDSYTMSSVLRACGGLGSVEEGDIIHGLIEKIGIKKDVIVNNGLLSMYCK 263



Score = 48.1 bits (113), Expect(2) = 3e-10
Identities = 25/89 (28%), Positives = 47/89 (52%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T++SI +AC +G++E H + D + + L++MY K G ++ + ++F +
Sbjct: 318 TITSILQACGHLGDLEFGKYVHDYMITSGYECDTTASNILINMYAKCGNLLASQEVFSGM 377

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
K+ V+WN MI Y G A++ F+
Sbjct: 378 KCKDSVSWNSMINVYIQNGSFDEAMKLFK 406



Score = 39.3 bits (90), Expect(2) = 3e-10
Identities = 21/57 (36%), Positives = 29/57 (50%)
Frame = -3

Query: 172 PDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*GRQDSS 2
PD VT++ L LG G+ +HC + S+ V +N+LVDMY K G S
Sbjct: 414 PDSVTYVMLLSMSTQLGDLHLGKELHCDLAKMGFNSNIVVSNTLVDMYAKCGEMGDS 470



Score = 42.7 bits (99), Expect(2) = 4e-08
Identities = 25/72 (34%), Positives = 34/72 (47%)
Frame = -3

Query: 232 SRACIVSTTDI*NMGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVF 53
S C + I M +G+ PD T LS L C +L +G+ IH + ESD
Sbjct: 495 SEDCNLGLRMISRMRTEGVTPDMATMLSILPVCSLLAAKRQGKEIHGCIFKLGLESDVPV 554

Query: 52 ANSLVDMYIK*G 17
N L++MY K G
Sbjct: 555 GNVLIEMYSKCG 566



Score = 37.7 bits (86), Expect(2) = 4e-08
Identities = 14/45 (31%), Positives = 29/45 (64%)
Frame = -1

Query: 366 DVSVGHALLDMYCKVGLIVEANKLFDLLPNKNVVTWNLMIGGYAH 232
++ V + L+DMY K G + ++ K+F+ + ++++TWN +I H
Sbjct: 450 NIVVSNTLVDMYAKCGEMGDSLKVFENMKARDIITWNTIIASCVH 494



Score = 43.1 bits (100), Expect(2) = 4e-05
Identities = 25/88 (28%), Positives = 41/88 (46%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T+ SI C + + H + DV VG+ L++MY K G + + ++F L+
Sbjct: 519 TMLSILPVCSLLAAKRQGKEIHGCIFKLGLESDVPVGNVLIEMYSKCGSLRNSFQVFKLM 578

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
K+VVTW +I G A++ F
Sbjct: 579 KTKDVVTWTALISACGMYGEGKKAVRAF 606



Score = 26.9 bits (58), Expect(2) = 4e-05
Identities = 12/29 (41%), Positives = 17/29 (58%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEG 107
M G+VPD V F++ + AC G+ EG
Sbjct: 609 MEAAGIVPDHVAFVAIIFACSHSGLVEEG 637



Score = 33.5 bits (75), Expect(2) = 0.033
Identities = 19/52 (36%), Positives = 26/52 (50%)
Frame = -3

Query: 178 LVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK 23
L PD TF S + AC L + IH +V+ SD N+L+DMY +
Sbjct: 111 LQPDTYTFPSVINACAGLLDFEMAKSIHDRVLDMGFGSDLYIGNALIDMYCR 162



Score = 26.6 bits (57), Expect(2) = 0.033
Identities = 11/28 (39%), Positives = 14/28 (50%)
Frame = -1

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTF 199
P+ NV WN +I H GL AL +
Sbjct: 76 PSNNVYLWNSIIRALTHNGLFSEALSLY 103


>tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192787 PE=4 SV=1
Length = 804

Score = 63.5 bits (153), Expect(2) = 4e-16
Identities = 31/84 (36%), Positives = 47/84 (55%)
Frame = -1

Query: 450 IAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLLPNKN 271
+ ++C+ ++ H L C +V + + LL +Y G + EA +LFD NK+
Sbjct: 34 LLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGSVNEARQLFDKFSNKS 93

Query: 270 VVTWNLMIGGYAHQGLALSALQTF 199
VV+WN+MI GYAH+GLA A F
Sbjct: 94 VVSWNVMISGYAHRGLAQEAFNLF 117



Score = 43.9 bits (102), Expect(2) = 4e-16
Identities = 25/59 (42%), Positives = 32/59 (54%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M Q+ L PD TF+S L AC V GR IH +V+ +DT N+L+ MY K G
Sbjct: 120 MQQERLEPDKFTFVSILSACSSPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCG 178



Score = 58.9 bits (141), Expect(2) = 4e-14
Identities = 29/94 (30%), Positives = 49/94 (52%)
Frame = -1

Query: 465 FTLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDL 286
FT SI AC + H +E A D +VG+AL+ MY K G + +A ++FD
Sbjct: 130 FTFVSILSACSSPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVFDA 189

Query: 285 LPNKNVVTWNLMIGGYAHQGLALSALQTFETWVK 184
+ +++ V+W + G YA G +L+T+ ++
Sbjct: 190 MASRDEVSWTTLTGAYAESGYGEESLKTYHAMLQ 223



Score = 42.0 bits (97), Expect(2) = 4e-14
Identities = 19/59 (32%), Positives = 33/59 (55%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M Q+ + P +T+++ L ACG L +G+ IH ++ + SD + +L MY+K G
Sbjct: 221 MLQERVRPSRITYMNVLSACGSLAALEKGKQIHAHIVESEYHSDVRVSTALTKMYMKCG 279



Score = 55.1 bits (131), Expect(2) = 1e-08
Identities = 29/89 (32%), Positives = 49/89 (55%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T + KAC + ++ H ++ D++V +AL+ MY K G + +A ++F+ +
Sbjct: 434 TYMCVLKACSNPVALKWGKEIHAEVVKAGLLADLAVTNALMSMYFKCGSVEDAIRVFEGM 493

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFE 196
++VVTWN +IGG G L ALQ +E
Sbjct: 494 SMRDVVTWNTLIGGLGQNGRGLEALQRYE 522



Score = 27.3 bits (59), Expect(2) = 1e-08
Identities = 12/30 (40%), Positives = 18/30 (60%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGR 104
M +G+ P+ TF++ L AC V + EGR
Sbjct: 524 MKSEGMRPNAATFVNVLSACRVCNLVEEGR 553



Score = 52.8 bits (125), Expect = 9e-06
Identities = 26/94 (27%), Positives = 50/94 (53%)
Frame = -1

Query: 462 TLSSIAKACIDVGEMEECFLAHFVTLECNDALDVSVGHALLDMYCKVGLIVEANKLFDLL 283
T +++ AC G + H + DV G+AL++MY K G + +A ++FD +
Sbjct: 333 TYTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAGSMKDARQVFDRM 392

Query: 282 PNKNVVTWNLMIGGYAHQGLALSALQTFETWVKR 181
P ++VV+W ++G YA + + TF+ +++
Sbjct: 393 PKRDVVSWTTLLGRYADCDQVVESFTTFKQMLQQ 426



Score = 40.4 bits (93), Expect = 0.044
Identities = 21/59 (35%), Positives = 31/59 (52%)
Frame = -3

Query: 193 MGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSLVDMYIK*G 17
M ++G+ PD T+ + L AC G G+ IH + SD F N+L++MY K G
Sbjct: 322 MLEEGVAPDRATYTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAG 380



Score = 36.2 bits (82), Expect = 0.83
Identities = 20/68 (29%), Positives = 34/68 (50%)
Frame = -3

Query: 220 IVSTTDI*NMGQKGLVPDDVTFLSALRACGVLGVALEGRLIHCQVIMRRHESDTVFANSL 41
+ S T M Q+G+ + +T++ L+AC G+ IH +V+ +D N+L
Sbjct: 414 VESFTTFKQMLQQGVKANKITYMCVLKACSNPVALKWGKEIHAEVVKAGLLADLAVTNAL 473

Query: 40 VDMYIK*G 17
+ MY K G
Sbjct: 474 MSMYFKCG 481