BP914889
Clone id YMU001_000064_A09
Library
Length 535
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000064_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCCTTCATCACTCTAAAGTCGCCCGCCCACTTGCAATATGCCTGAGCTTCAGCCAAGC
TCACAAACACCGGCTCACTTGCTATTTCCTTCCAGTGTTTTGTCGTGGCATGTCCATGTA
TGTAGAAATCACCTCCCAAATATGACCATGTTGCCGGCCACTTGTACCCGTTCTCCTTGA
AATGCACAAAATCTTCATTCTCCCATAAATGCTTCCGGTCATATCCACCATCTCTGACAA
ATTCCATGTACTCTTCAATGCTTACGGGCCACCTACTCACAATAAATGCATCAGTTACAA
ATGTCTCCACCAATGGAACCTCATTGTCCCAGACAAACATGGAATCGGACTGCTGCGATC
CCATTGAAATTTTTCCTGGTAATATCTTCACATTCGGGATATTGCACTTTGGAATCGCTC
CATCATTGCTATTCACACCATCCTGTTTCTGCCCATTAGATTCTCCATTTGATCCAATAT
TTGTTGAAAATGTTCTTTTAAAGTTGGCCTTAATTTGCTGAGAAAGCATGTATGC
■■Homology search results ■■ -
sp_hit_id Q5RCR5
Definition sp|Q5RCR5|SUMF2_PONAB Sulfatase-modifying factor 2 OS=Pongo abelii
Align length 134
Score (bit) 33.9
E-value 0.51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914889|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_A09.
(535 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5RCR5|SUMF2_PONAB Sulfatase-modifying factor 2 OS=Pongo abel... 34 0.51
sp|Q8NBJ7|SUMF2_HUMAN Sulfatase-modifying factor 2 OS=Homo sapie... 34 0.51
sp|Q8NBK3|SUMF1_HUMAN Sulfatase-modifying factor 1 OS=Homo sapie... 33 0.87
sp|O94632|MU158_SCHPO Meiotically up-regulated gene 158 protein ... 33 0.87
sp|Q8R0F3|SUMF1_MOUSE Sulfatase-modifying factor 1 OS=Mus muscul... 32 1.5
sp|Q8BPG6|SUMF2_MOUSE Sulfatase-modifying factor 2 OS=Mus muscul... 32 1.9
sp|Q0P5L5|SUMF1_BOVIN Sulfatase-modifying factor 1 OS=Bos taurus... 32 1.9
sp|Q54TN2|MYBC_DICDI Myb-like protein C OS=Dictyostelium discoid... 32 2.5
sp|Q9W3K5|GSH1_DROME Glutamate--cysteine ligase OS=Drosophila me... 30 5.7
sp|P36135|UTH1_YEAST Protein UTH1 OS=Saccharomyces cerevisiae GN... 30 7.4
sp|Q6P6V7|EAPA2_RAT Experimental autoimmune prostatitis antigen ... 30 9.5
sp|Q6C882|STU1_YARLI Protein STU1 OS=Yarrowia lipolytica GN=STU1... 30 9.7
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp.... 30 9.7

>sp|Q5RCR5|SUMF2_PONAB Sulfatase-modifying factor 2 OS=Pongo abelii
GN=SUMF2 PE=2 SV=1
Length = 301

Score = 33.9 bits (76), Expect = 0.51
Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 11/134 (8%)
Frame = -1

Query: 391 VKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRK 212
V++ G+ MG+ DS D E P+ E V F + +PV+ +++ +FVR+ Y +
Sbjct: 31 VQLQGGRFLMGTNSPDSR---DGEGPVREATVKP-FAIDIFPVTNKDFRDFVREKKYRTE 86

Query: 211 HLWENEDFVH--FKENGYKWPAT--------WSYLGGDFYIHGHATTKHWKEIASEPVF- 65
FV F + + AT W + F+ +E PV
Sbjct: 87 AEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLH 146

Query: 64 VSLAEAQAYCKWAG 23
VS +A+AYC W G
Sbjct: 147 VSWNDARAYCAWRG 160


>sp|Q8NBJ7|SUMF2_HUMAN Sulfatase-modifying factor 2 OS=Homo sapiens
GN=SUMF2 PE=1 SV=1
Length = 301

Score = 33.9 bits (76), Expect = 0.51
Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 11/134 (8%)
Frame = -1

Query: 391 VKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRK 212
V++ G+ MG+ DS D E P+ E V F + +PV+ +++ +FVR+ Y +
Sbjct: 31 VQLQGGRFLMGTNSPDSR---DGEGPVREATVKP-FAIDIFPVTNKDFRDFVREKKYRTE 86

Query: 211 HLWENEDFVH--FKENGYKWPAT--------WSYLGGDFYIHGHATTKHWKEIASEPVF- 65
FV F + + AT W + F+ +E PV
Sbjct: 87 AEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLH 146

Query: 64 VSLAEAQAYCKWAG 23
VS +A+AYC W G
Sbjct: 147 VSWNDARAYCAWRG 160


>sp|Q8NBK3|SUMF1_HUMAN Sulfatase-modifying factor 1 OS=Homo sapiens
GN=SUMF1 PE=1 SV=3
Length = 374

Score = 33.1 bits (74), Expect = 0.87
Identities = 44/167 (26%), Positives = 67/167 (40%), Gaps = 16/167 (9%)
Frame = -1

Query: 475 GSNGESNGQKQDGVNSN-DGAIP-KCNIPNVKILP---GKISMGSQQSDSMFVWDNEVPL 311
G++G S + +N G +P + + + K++P G +MG+ D D E P
Sbjct: 59 GAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTD--DPQIKQDGEAPA 116

Query: 310 VETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRKHLWENEDFV-------HFKENGYKWPA 152
+ DAF + + VS E+ +FV GY + + FV K N + A
Sbjct: 117 RRVTI-DAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVA 175

Query: 151 T---WSYLGGDFYIHGHATTKHWKEIASEPVF-VSLAEAQAYCKWAG 23
W + G + H PV VS +A AYC WAG
Sbjct: 176 AAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAG 222


>sp|O94632|MU158_SCHPO Meiotically up-regulated gene 158 protein
OS=Schizosaccharomyces pombe GN=mug158 PE=1 SV=4
Length = 773

Score = 33.1 bits (74), Expect = 0.87
Identities = 25/105 (23%), Positives = 42/105 (40%)
Frame = -1

Query: 337 FVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRKHLWENEDFVHFKENGYKW 158
F WDNE P+ + V+ +F ++ P+S EY++F+ ++K E +
Sbjct: 560 FAWDNEKPMRKKLVS-SFSIANRPISNGEYLDFI-----NKKSKTER-----------VY 602

Query: 157 PATWSYLGGDFYIHGHATTKHWKEIASEPVFVSLAEAQAYCKWAG 23
P W+ + G YI + PV S + Y G
Sbjct: 603 PKQWAEIDGTLYIRTMYGLLPLDDYLGWPVMTSYDDLNNYASSQG 647


>sp|Q8R0F3|SUMF1_MOUSE Sulfatase-modifying factor 1 OS=Mus musculus
GN=Sumf1 PE=1 SV=2
Length = 372

Score = 32.3 bits (72), Expect = 1.5
Identities = 44/174 (25%), Positives = 62/174 (35%), Gaps = 23/174 (13%)
Frame = -1

Query: 475 GSNGESNGQKQDGVNSN-----DGAIPKCNIPNVKILPGKISMGSQQSDSMFVWDNEVPL 311
G++G S ++ +N G P V I G +MG+ D D E P
Sbjct: 57 GAHGSSAAAQRYSREANAPGLTSGPRPLALTKMVPIPAGVFTMGTD--DPQIRQDGEAPA 114

Query: 310 VETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRKHLWENEDF-----------------VH 182
V D F + + VS ++ +FV GY L E E F +H
Sbjct: 115 RRVTV-DGFYMDAYEVSNADFEKFVNSTGY----LTEAEKFGDSFVFEGMLSEQVKTHIH 169

Query: 181 FKENGYKWPATWSYLGGDFYIHGHATTKHWKEIASEPVF-VSLAEAQAYCKWAG 23
W W + G + H ++ PV VS +A AYC WAG
Sbjct: 170 QAVAAAPW---WLPVKGANWRHPEGPDSSILHRSNHPVLHVSWNDAVAYCTWAG 220


>sp|Q8BPG6|SUMF2_MOUSE Sulfatase-modifying factor 2 OS=Mus musculus
GN=Sumf2 PE=2 SV=1
Length = 308

Score = 32.0 bits (71), Expect = 1.9
Identities = 37/128 (28%), Positives = 53/128 (41%), Gaps = 10/128 (7%)
Frame = -1

Query: 376 GKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRKHL--- 206
G+ MG+ D D E P E V F + +PV+ +++ EFVR+ Y +
Sbjct: 44 GRFLMGTDAPDGR---DGEGPAREVTVKP-FAIDIFPVTNKDFREFVREKKYQTEAEAFG 99

Query: 205 WEN--EDFV--HFKENGYKWPAT--WSYLGGDFYIHGHATTKHWKEIASEPVF-VSLAEA 47
W EDFV ++ PA W + F+ +E PV VS +A
Sbjct: 100 WSFVFEDFVSPELRKQENLMPAVHWWQPVPKAFWRQPAGPGSGIREKLELPVVHVSWNDA 159

Query: 46 QAYCKWAG 23
AYC W G
Sbjct: 160 GAYCAWRG 167


>sp|Q0P5L5|SUMF1_BOVIN Sulfatase-modifying factor 1 OS=Bos taurus
GN=SUMF1 PE=2 SV=1
Length = 374

Score = 32.0 bits (71), Expect = 1.9
Identities = 38/139 (27%), Positives = 54/139 (38%), Gaps = 14/139 (10%)
Frame = -1

Query: 397 PNVKILP---GKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDG 227
P K++P G +MG+ D D E P + DAF + + VS E+ +FV
Sbjct: 87 PPTKMVPIPAGVFTMGTD--DPQIKQDGEAPARRVAI-DAFYMDAYEVSNAEFEKFVNST 143

Query: 226 GYDRKHLWENEDFV-------HFKENGYKWPAT---WSYLGGDFYIHGHATTKHWKEIAS 77
GY + + FV K + + A W + G + H
Sbjct: 144 GYLTEAEKFGDSFVFEGMLSEQVKSDIQQAVAAAPWWLPVKGANWRHPEGPDSTVLHRPD 203

Query: 76 EPVF-VSLAEAQAYCKWAG 23
PV VS +A AYC WAG
Sbjct: 204 HPVLHVSWNDAVAYCTWAG 222


>sp|Q54TN2|MYBC_DICDI Myb-like protein C OS=Dictyostelium discoideum
GN=mybC PE=1 SV=1
Length = 580

Score = 31.6 bits (70), Expect = 2.5
Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 1/72 (1%)
Frame = -1

Query: 526 LSQQIKANFKRTFSTNIG-SNGESNGQKQDGVNSNDGAIPKCNIPNVKILPGKISMGSQQ 350
LS + + + T++ N SN SN + N+N+ C +PNV S GS
Sbjct: 7 LSYPVPSQYSYTYNNNNNNSNNSSNNNSNNNSNNNNNNNNNCGVPNV-------SYGSNL 59

Query: 349 SDSMFVWDNEVP 314
+ D VP
Sbjct: 60 NQQSMAQDLRVP 71


>sp|Q9W3K5|GSH1_DROME Glutamate--cysteine ligase OS=Drosophila
melanogaster GN=Gclc PE=2 SV=1
Length = 717

Score = 30.4 bits (67), Expect = 5.7
Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
Frame = -1

Query: 493 TFSTNIGSNGESNGQKQDGVNSNDGAIPKCNIPNV-KILPGKISMGSQQSDSMFVWDNEV 317
T TN SNG SNG D +++D + ++ +I GK + V+ V
Sbjct: 553 TNGTNGSSNGSSNGTDSDHTDTDDEENELFQLLSINEIFNGKPN----------VFPGLV 602

Query: 316 PLVETFVTDAFIVSRWPVSIEEYMEFVR 233
PL+ +++ + + +IE+Y+ F++
Sbjct: 603 PLIRSYLQSMEVDTDTHCTIEQYLRFIQ 630


>sp|P36135|UTH1_YEAST Protein UTH1 OS=Saccharomyces cerevisiae
GN=UTH1 PE=1 SV=1
Length = 450

Score = 30.0 bits (66), Expect = 7.4
Identities = 12/58 (20%), Positives = 29/58 (50%)
Frame = +1

Query: 310 PMEPHCPRQTWNRTAAIPLKFFLVISSHSGYCTLESLHHCYSHHPVSAH*ILHLIQYL 483
P+ + P ++R +++ L L +S+ + ++HH +HH ++ + QY+
Sbjct: 70 PLNKNLPSLNFSRNSSMKLSALLALSASTAVLAAPAVHHSDNHHHNDKRAVVTVTQYV 127


tr_hit_id A7HV79
Definition tr|A7HV79|A7HV79_PARL1 Putative uncharacterized protein OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Align length 108
Score (bit) 76.6
E-value 7.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914889|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_A09.
(535 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7HV79|A7HV79_PARL1 Putative uncharacterized protein OS=Parvi... 77 7e-13
tr|B6BMF5|B6BMF5_9PROT Generic methyltransferase OS=Campylobacte... 72 2e-11
tr|Q2Y6S2|Q2Y6S2_NITMU Putative uncharacterized protein OS=Nitro... 70 5e-11
tr|A0RUJ0|A0RUJ0_CENSY Putative uncharacterized protein OS=Cenar... 69 1e-10
tr|B3TBI4|B3TBI4_9CREN Putative uncharacterized protein OS=uncul... 68 3e-10
tr|B3T7Y3|B3T7Y3_9CREN Putative uncharacterized protein OS=uncul... 68 3e-10
tr|A4FGC1|A4FGC1_SACEN Sulfatase modifying factor OS=Saccharopol... 67 8e-10
tr|A7H7T2|A7H7T2_ANADF Putative uncharacterized protein OS=Anaer... 64 4e-09
tr|A9A3C4|A9A3C4_NITMS Putative uncharacterized protein OS=Nitro... 64 5e-09
tr|A3IYQ6|A3IYQ6_9CHRO Putative uncharacterized protein OS=Cyano... 64 6e-09
tr|Q30TC3|Q30TC3_SULDN Putative uncharacterized protein OS=Sulfu... 63 8e-09
tr|B2ID60|B2ID60_BEII9 Putative uncharacterized protein OS=Beije... 63 1e-08
tr|Q11A78|Q11A78_TRIEI Putative uncharacterized protein OS=Trich... 62 1e-08
tr|B2JQK5|B2JQK5_BURP8 Putative uncharacterized protein OS=Burkh... 62 1e-08
tr|A5GQ64|A5GQ64_SYNR3 Uncharacterised conserved secreted protei... 62 1e-08
tr|B5SF01|B5SF01_RALSO Putative uncharacterized protein OS=Ralst... 62 2e-08
tr|A3RP87|A3RP87_RALSO Hypothetical cytosolic protein OS=Ralston... 62 2e-08
tr|B5W054|B5W054_SPIMA Putative uncharacterized protein OS=Arthr... 61 3e-08
tr|Q15PM3|Q15PM3_PSEA6 Putative uncharacterized protein OS=Pseud... 61 4e-08
tr|B2U8M8|B2U8M8_RALPJ Putative uncharacterized protein OS=Ralst... 61 4e-08
tr|A7CMA5|A7CMA5_BURPI Putative uncharacterized protein OS=Ralst... 61 4e-08
tr|Q8Y0U2|Q8Y0U2_RALSO Putative uncharacterized protein OS=Ralst... 60 5e-08
tr|Q489A9|Q489A9_COLP3 Putative uncharacterized protein OS=Colwe... 60 5e-08
tr|Q2YZK2|Q2YZK2_9PROT Putative uncharacterized protein OS=uncul... 60 5e-08
tr|Q2Y7Q2|Q2Y7Q2_NITMU Putative uncharacterized protein OS=Nitro... 60 7e-08
tr|Q82SD9|Q82SD9_NITEU Generic methyltransferase OS=Nitrosomonas... 60 9e-08
tr|Q0HNM3|Q0HNM3_SHESM Putative uncharacterized protein OS=Shewa... 57 1e-07
tr|A6Q798|A6Q798_SULNB Putative uncharacterized protein OS=Sulfu... 59 1e-07
tr|B5I148|B5I148_9ACTO Putative uncharacterized protein OS=Strep... 59 1e-07
tr|B3PGP8|B3PGP8_CELJU Generic methyltransferase OS=Cellvibrio j... 59 2e-07

>tr|A7HV79|A7HV79_PARL1 Putative uncharacterized protein
OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023
/ NCIMB 13966) GN=Plav_2198 PE=4 SV=1
Length = 430

Score = 76.6 bits (187), Expect = 7e-13
Identities = 43/108 (39%), Positives = 58/108 (53%), Gaps = 3/108 (2%)
Frame = -1

Query: 337 FVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRKHLWENEDFVHFKENGYKW 158
F +DNE P F+ DA I SR PVS+ EY++F+ DGGY R LW ++ + K NG+
Sbjct: 215 FAFDNEGPAHSVFLHDARIASR-PVSVGEYLDFIADGGYSRSELWLSDGWEAVKANGWDS 273

Query: 157 PATWSYLGG---DFYIHGHATTKHWKEIASEPVFVSLAEAQAYCKWAG 23
PA W G + +HG + + +A VS EA AY WAG
Sbjct: 274 PAYWEKEGAVWMTYTLHGRRPVREDEPVA----HVSFYEAAAYASWAG 317


>tr|B6BMF5|B6BMF5_9PROT Generic methyltransferase
OS=Campylobacterales bacterium GD 1 GN=CBGD1_1979 PE=4
SV=1
Length = 699

Score = 71.6 bits (174), Expect = 2e-11
Identities = 43/135 (31%), Positives = 73/135 (54%), Gaps = 1/135 (0%)
Frame = -1

Query: 430 SNDGAIPKCNIPNVKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEE 251
S+ A PK + ++K I +G +++ ++ WDNE E V + F S++ VS E
Sbjct: 185 SHSSAAPKNEMLSIKAQ--HIELGKEKTHHLYGWDNEYGTYEEDVKE-FKTSKYLVSNSE 241

Query: 250 YMEFVRDGGYDRKHLWENEDFVHFKENGYKWPATWSYLGGDFYIHGHATTKHWKEIASE- 74
YMEFV+DGGY+ + W++E K++ +P W GD+ + T E+ +
Sbjct: 242 YMEFVKDGGYETEEFWDDEGREFLKDSKAAYPTFWVLENGDY---RYRTISKLIEMPLDW 298

Query: 73 PVFVSLAEAQAYCKW 29
PV V+ EA+A+C++
Sbjct: 299 PVDVNALEAEAFCRY 313


>tr|Q2Y6S2|Q2Y6S2_NITMU Putative uncharacterized protein
OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB
11849) GN=Nmul_A2257 PE=4 SV=1
Length = 726

Score = 70.5 bits (171), Expect = 5e-11
Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 2/123 (1%)
Frame = -1

Query: 391 VKILPGKISMGSQQSDSMFVWDNEVPLVETFVTD--AFIVSRWPVSIEEYMEFVRDGGYD 218
VK+ G + +G ++ D + WDNE T + D AF ++ VS +E++EFV+ GY+
Sbjct: 220 VKVPEGTVQLGKKKDDPFYGWDNEYG---THIADVAAFEAGKYLVSNQEFLEFVQADGYE 276

Query: 217 RKHLWENEDFVHFKENGYKWPATWSYLGGDFYIHGHATTKHWKEIASEPVFVSLAEAQAY 38
+ WE E K G K P W GG++ + TK PV V+ EA+A+
Sbjct: 277 TESYWEEEGRAWLKHAGAKHPTFWIRRGGEWEL--RLMTKEISMPWDWPVEVNYHEAKAF 334

Query: 37 CKW 29
C W
Sbjct: 335 CNW 337


>tr|A0RUJ0|A0RUJ0_CENSY Putative uncharacterized protein
OS=Cenarchaeum symbiosum GN=CENSYa_0371 PE=4 SV=1
Length = 434

Score = 69.3 bits (168), Expect = 1e-10
Identities = 39/106 (36%), Positives = 58/106 (54%), Gaps = 1/106 (0%)
Frame = -1

Query: 337 FVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDRKHLWENEDFVHFKENGYKW 158
F +D E+P ++ D + + +PV+ EY+ F+ DGGY W ++ + KENG+
Sbjct: 192 FCYDVELPEHRVYLED-YTIGAYPVTNGEYLLFMEDGGYGSYRHWLSDGWDRVKENGWNS 250

Query: 157 PATWSYLGGDFYIHGHATTKHWKEIASEPV-FVSLAEAQAYCKWAG 23
P W G ++Y +G A + K EPV VS EA AYC+WAG
Sbjct: 251 PMYWEKEGDEWYTNGLAGRR--KINPKEPVCHVSFYEADAYCRWAG 294


>tr|B3TBI4|B3TBI4_9CREN Putative uncharacterized protein
OS=uncultured marine crenarchaeote HF4000_APKG9P22
GN=ALOHA_HF4000APKG9P22ctg1g11 PE=4 SV=1
Length = 434

Score = 67.8 bits (164), Expect = 3e-10
Identities = 42/125 (33%), Positives = 65/125 (52%), Gaps = 1/125 (0%)
Frame = -1

Query: 394 NVKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDR 215
++KI G MG S F +D E+P + ++ D + + +PV+ ++YM+FV DGGYD
Sbjct: 177 SIKINGGLYMMG--YSGDQFCYDIELPEHKVYLDD-YKIDSFPVTNKQYMKFVEDGGYDD 233

Query: 214 KHLWENEDFVHFKENGYKWPATWSYLGGDFYIHGHATTKHWKEIASEPV-FVSLAEAQAY 38
W ++ + + +K P W + G + + K +EPV VS EA AY
Sbjct: 234 FKYWLSDGWDKIRNENWKTPMYWKKIDGQWMTCDFLGNR--KVNPNEPVCHVSYYEADAY 291

Query: 37 CKWAG 23
CKWAG
Sbjct: 292 CKWAG 296


>tr|B3T7Y3|B3T7Y3_9CREN Putative uncharacterized protein
OS=uncultured marine crenarchaeote HF4000_APKG3K8
GN=ALOHA_HF4000APKG3K8ctg1g25 PE=4 SV=1
Length = 434

Score = 67.8 bits (164), Expect = 3e-10
Identities = 42/125 (33%), Positives = 65/125 (52%), Gaps = 1/125 (0%)
Frame = -1

Query: 394 NVKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDR 215
++KI G MG S F +D E+P + ++ D + + +PV+ ++YM+FV DGGYD
Sbjct: 177 SIKINGGLYMMG--YSGDQFCYDIELPEHKVYLDD-YKIDSFPVTNKQYMKFVEDGGYDD 233

Query: 214 KHLWENEDFVHFKENGYKWPATWSYLGGDFYIHGHATTKHWKEIASEPV-FVSLAEAQAY 38
W ++ + + +K P W + G + + K +EPV VS EA AY
Sbjct: 234 FKYWLSDGWDKIRNENWKTPMYWKKIDGQWMTCDFLGNR--KVNPNEPVCHVSYYEADAY 291

Query: 37 CKWAG 23
CKWAG
Sbjct: 292 CKWAG 296


>tr|A4FGC1|A4FGC1_SACEN Sulfatase modifying factor
OS=Saccharopolyspora erythraea (strain NRRL 23338)
GN=SACE_3825 PE=4 SV=1
Length = 449

Score = 66.6 bits (161), Expect = 8e-10
Identities = 53/143 (37%), Positives = 69/143 (48%), Gaps = 5/143 (3%)
Frame = -1

Query: 436 VNSNDGAIPKCNIPNVKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSI 257
V ++ G++P P V + G MG+ S + DNE P E V DAF + PVS
Sbjct: 173 VAADAGSLP----PEVLVPGGPFVMGT--STEPWALDNERPAHEVEV-DAFFIDTTPVSN 225

Query: 256 EEYMEFVRDGGYDRKHLWENEDFVHFKENGYKWPATWSYLG-GDFYIH---GHATTKHWK 89
E++ F+ DGGYDR LW E + + + P W G GD ++ GH
Sbjct: 226 GEFLRFIDDGGYDRAELWSPEGWAYRCRAELRAPRFWERDGDGDRWLRRRFGHVEPVP-- 283

Query: 88 EIASEP-VFVSLAEAQAYCKWAG 23
A EP V VS EAQAY WAG
Sbjct: 284 --AREPVVHVSFHEAQAYATWAG 304


>tr|A7H7T2|A7H7T2_ANADF Putative uncharacterized protein
OS=Anaeromyxobacter sp. (strain Fw109-5) GN=Anae109_0564
PE=4 SV=1
Length = 424

Score = 64.3 bits (155), Expect = 4e-09
Identities = 43/128 (33%), Positives = 64/128 (50%), Gaps = 4/128 (3%)
Frame = -1

Query: 394 NVKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDR 215
+V++ G + +G+++ + FV+DNE F +SR PV+ + EFV DGGY R
Sbjct: 162 DVEVPGGTLRLGAERGEG-FVFDNE-KWAHAVELAPFRISRAPVTQARFAEFVEDGGYRR 219

Query: 214 KHLWENEDFVHFKENGYKWPATWSYLGGDFYIHGHATTKHWKEIASEP----VFVSLAEA 47
+ W E + + G PA W GG ++ W + EP V VS EA
Sbjct: 220 REWWTEEGWRWREATGAGAPAYWERRGGSWF---RRDFDRW--VPLEPHRPVVNVSWFEA 274

Query: 46 QAYCKWAG 23
QA+C+WAG
Sbjct: 275 QAFCRWAG 282


>tr|A9A3C4|A9A3C4_NITMS Putative uncharacterized protein
OS=Nitrosopumilus maritimus (strain SCM1) GN=Nmar_0657
PE=4 SV=1
Length = 436

Score = 63.9 bits (154), Expect = 5e-09
Identities = 37/125 (29%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
Frame = -1

Query: 394 NVKILPGKISMGSQQSDSMFVWDNEVPLVETFVTDAFIVSRWPVSIEEYMEFVRDGGYDR 215
+V+I G +MG + F +D E+P + ++ + + + +P++ ++Y+EF+ DGGY+
Sbjct: 179 SVQINGGLYTMGF--NGKKFCYDIELPEHKVYLNN-YKIDVFPITNKQYLEFIEDGGYET 235

Query: 214 KHLWENEDFVHFKENGYKWPATWSYLGGDFYIHGHATTKHWKEIASEPV-FVSLAEAQAY 38
W ++ + K+N + P W + G + + + +EPV VS EA AY
Sbjct: 236 YKYWLSDGWEKVKDNKWNAPMYWEKVNGKWNVRDFLGIREIN--PNEPVCHVSFYEADAY 293

Query: 37 CKWAG 23
CKWAG
Sbjct: 294 CKWAG 298


>tr|A3IYQ6|A3IYQ6_9CHRO Putative uncharacterized protein
OS=Cyanothece sp. CCY 0110 GN=CY0110_09510 PE=4 SV=1
Length = 448

Score = 63.5 bits (153), Expect = 6e-09
Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 5/135 (3%)
Frame = -1

Query: 391 VKILPGKISMGSQQSDSMFVWDNEVPLVETFV-TDAFIVSRWPVSIEEYMEFVRDGGYDR 215
+ I G + +G + + ++ WD E + FV D+F+ S++ V+ E+++FV GY+
Sbjct: 195 ILIKGGTVKLGKTKDNPLYGWDCEYG--DRFVKVDSFLASQYLVTNAEFLKFVNSKGYEN 252

Query: 214 KHLWENEDFVHFKENGYKWPATWSYLGGDFYIHGHATTKHWKEI---ASEPVFVSLAEAQ 44
K W + + +EN K P W + G + A + EI + PV V+ EA
Sbjct: 253 KDYWNEKSWQWKEENNIKNPKFWQFKNGQY-----AYRAMFDEIPLPLNWPVEVNYYEAI 307

Query: 43 AYCKWAGD-FRVMKE 2
AYC+W G+ R+M E
Sbjct: 308 AYCRWKGENTRLMSE 322