BP914901
Clone id YMU001_000064_B09
Library
Length 472
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000064_B09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GACAGAACTCCGACAGAGCTTCGCATGCATAACAAAGCATTGCTTGTGAATTTGGAGAAC
TCAGACTGGCATTGGCGTACGTATCTACCACATGGCTCCAACAGAGATCATGCTGTTTGC
AATGTGATGGGCCCTAATGCTCCAGATCTGTCCATGCTGCAGCTTCCTCGGTCGCTTGTC
ACCATCGCCGAATTTGACATTTTGAAAGACTGGCAGCTTCGATATGCGCAGGGTCTGGTG
CAGGCACCGAAGCCAGTCCAACTCCTCTATTATACAGGAGGGATACACTCCTTCCATGTA
TTGGGAGACAGGAAGCTTGGGTCACGCATGTTGTCAGACATTGTGGCATTTATTGAGGAT
GGGGATGGCAAGCGAAGCGCGGAGTCCGCTGTAGCATCAGCGAAGTGAGATTGTTGTGTT
TGTGGTCTCAATGTTGGTCATGTGTGCCCAAGAGCAACAGGTAATGGATGCA
■■Homology search results ■■ -
sp_hit_id Q940G6
Definition sp|Q940G6|GI1L3_ARATH Probable gibberellin receptor GID1L3 OS=Arabidopsis thaliana
Align length 118
Score (bit) 97.4
E-value 3.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914901|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_B09.
(472 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q940G6|GI1L3_ARATH Probable gibberellin receptor GID1L3 OS=Ar... 97 3e-20
sp|Q9LYC1|GI1L2_ARATH Probable gibberellin receptor GID1L2 OS=Ar... 91 3e-18
sp|Q9MAA7|GI1L1_ARATH Probable gibberellin receptor GID1L1 OS=Ar... 88 2e-17
sp|Q6L545|GID1_ORYSJ Gibberellin receptor GID1 OS=Oryza sativa s... 71 2e-12
sp|Q5UQ83|YR526_MIMIV Putative alpha/beta hydrolase R526 OS=Acan... 38 0.026
sp|P14326|VSH5_DICDI Vegetative-specific protein H5 OS=Dictyoste... 36 0.076
sp|A7MBM2|DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapie... 35 0.17
sp|Q8BM81|ADCL4_MOUSE Arylacetamide deacetylase-like 4 OS=Mus mu... 35 0.17
sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144) GN... 35 0.22
sp|Q5R8Y5|ADCL1_PONAB Arylacetamide deacetylase-like 1 OS=Pongo ... 32 1.4
sp|Q6PIU2|ADCL1_HUMAN Arylacetamide deacetylase-like 1 OS=Homo s... 32 1.9
sp|Q1JQE6|ADCL1_BOVIN Arylacetamide deacetylase-like 1 OS=Bos ta... 31 2.4
sp|P48595|SPB10_HUMAN Serpin B10 OS=Homo sapiens GN=SERPINB10 PE... 31 3.2
sp|Q8CIP5|DISP2_MOUSE Protein dispatched homolog 2 OS=Mus muscul... 30 5.3
sp|Q9HCE0|K1632_HUMAN UPF0493 protein KIAA1632 OS=Homo sapiens G... 30 5.4
sp|Q54MV7|NDUAC_DICDI NADH dehydrogenase [ubiquinone] 1 alpha su... 30 7.1
sp|Q5VUY0|ADCL3_HUMAN Arylacetamide deacetylase-like 3 OS=Homo s... 30 7.1
sp|Q7VFF0|SYP_HELHP Prolyl-tRNA synthetase OS=Helicobacter hepat... 29 9.3
sp|Q8ZRA1|AES_SALTY Acetyl esterase OS=Salmonella typhimurium GN... 29 9.3
sp|Q8Z8T1|AES_SALTI Acetyl esterase OS=Salmonella typhi GN=aes P... 29 9.3
sp|Q5PFJ2|AES_SALPA Acetyl esterase OS=Salmonella paratyphi A GN... 29 9.3
sp|Q57S73|AES_SALCH Acetyl esterase OS=Salmonella choleraesuis G... 29 9.3
sp|Q5VUY2|ADCL4_HUMAN Arylacetamide deacetylase-like 4 OS=Homo s... 29 9.3
sp|B2GV54|ADCL1_RAT Arylacetamide deacetylase-like 1 OS=Rattus n... 29 9.3
sp|Q8BLF1|ADCL1_MOUSE Arylacetamide deacetylase-like 1 OS=Mus mu... 29 9.3

>sp|Q940G6|GI1L3_ARATH Probable gibberellin receptor GID1L3
OS=Arabidopsis thaliana GN=GID1L3 PE=2 SV=1
Length = 344

Score = 97.4 bits (241), Expect = 3e-20
Identities = 44/118 (37%), Positives = 72/118 (61%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RT +E R+ K V + + DW+WR +LP G +R+H C+ GP + L L P+SLV
Sbjct: 223 ERTESEKRLDGK-YFVTVRDRDWYWRAFLPEGEDREHPACSPFGPRSKSLEGLSFPKSLV 281

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFI 354
+A D+++DWQL+YA+GL +A + V+LLY F++L + ++ +I AF+
Sbjct: 282 VVAGLDLIQDWQLKYAEGLKKAGQEVKLLYLEQATIGFYLLPNNNHFHTVMDEIAAFV 339


>sp|Q9LYC1|GI1L2_ARATH Probable gibberellin receptor GID1L2
OS=Arabidopsis thaliana GN=GID1L2 PE=2 SV=1
Length = 358

Score = 90.5 bits (223), Expect = 3e-18
Identities = 44/131 (33%), Positives = 68/131 (51%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RT +E + K V +++ DW+WR YLP G +RDH CN GP L + P+SLV
Sbjct: 225 ERTQSEKTLDGK-YFVTIQDRDWYWRAYLPEGEDRDHPACNPFGPRGQSLKGVNFPKSLV 283

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFIED 360
+A D+++DWQL Y GL + V LLY F+ L + ++ ++ F+
Sbjct: 284 VVAGLDLVQDWQLAYVDGLKKTGLEVNLLYLKQATIGFYFLPNNDHFHCLMEELNKFVHS 343

Query: 361 GDGKRSAESAV 393
+ +S S V
Sbjct: 344 IEDSQSKSSPV 354


>sp|Q9MAA7|GI1L1_ARATH Probable gibberellin receptor GID1L1
OS=Arabidopsis thaliana GN=GID1L1 PE=1 SV=1
Length = 345

Score = 88.2 bits (217), Expect = 2e-17
Identities = 39/118 (33%), Positives = 68/118 (57%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RT +E + K V + + DW+W+ +LP G +R+H CN P L + P+SLV
Sbjct: 225 ERTESEKSLDGK-YFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLV 283

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFI 354
+A D+++DWQL YA+GL +A + V+L++ F++L + ++ +I AF+
Sbjct: 284 VVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFV 341


>sp|Q6L545|GID1_ORYSJ Gibberellin receptor GID1 OS=Oryza sativa
subsp. japonica GN=GID1 PE=1 SV=1
Length = 354

Score = 71.2 bits (173), Expect = 2e-12
Identities = 37/118 (31%), Positives = 62/118 (52%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RT +E R+ K V L++ DW+W+ YLP ++RDH CN GPN L L +SL+
Sbjct: 232 ERTESERRLDGK-YFVTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLI 290

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFI 354
++ D+ D QL YA L + V+++ F++L + ++ +I F+
Sbjct: 291 IVSGLDLTCDRQLAYADALREDGHHVKVVQCENATVGFYLLPNTVHYHEVMEEISDFL 348


>sp|Q5UQ83|YR526_MIMIV Putative alpha/beta hydrolase R526
OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R526 PE=1
SV=1
Length = 346

Score = 37.7 bits (86), Expect = 0.026
Identities = 23/83 (27%), Positives = 41/83 (49%)
Frame = +1

Query: 55 ENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLVTIAEFDILKDWQLRYAQG 234
++ +W + Y N++ + ++ NA D S+ LP +L+ + E D+L+D YA
Sbjct: 237 KSMEWFYEQYTE--PNQNLMIPSISPINATDRSIQYLPPTLLVVDENDVLRDEGEAYAHR 294

Query: 235 LVQAPKPVQLLYYTGGIHSFHVL 303
L P + + G IH F +L
Sbjct: 295 LSNLGVPTKSVRVLGTIHDFMLL 317


>sp|P14326|VSH5_DICDI Vegetative-specific protein H5
OS=Dictyostelium discoideum GN=cinB PE=2 SV=2
Length = 337

Score = 36.2 bits (82), Expect = 0.076
Identities = 28/96 (29%), Positives = 36/96 (37%)
Frame = +1

Query: 7 TPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLVTI 186
TP+ R K L E W W Y + S RD C + L P +LV
Sbjct: 201 TPSYNRFSEKFYLTK-EGMKWCWNHYTNNDSERDEITCCPLKATIDQLK--DFPETLVIT 257

Query: 187 AEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSF 294
AE D+L ++ L A V +L IH F
Sbjct: 258 AETDVLSSEGEQFGLKLSNANVKVSVLRILKTIHGF 293


>sp|A7MBM2|DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapiens
GN=DISP2 PE=2 SV=2
Length = 1401

Score = 35.0 bits (79), Expect = 0.17
Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
Frame = -3

Query: 266 RSWTGFGA-CTRPCAYRSCQSFKMSNSAMVTSDRGSCSMDRSGALGPITLQTA*SLLEPC 90
RS T FGA C R A + C S+ + N V S+R SC +D + A TL +LL C
Sbjct: 317 RSHTSFGALCQRTAANQCCPSWSLGNYLAVLSNRSSC-LDTTQADAARTL----ALLRTC 371

Query: 89 GRY 81
Y
Sbjct: 372 ALY 374


>sp|Q8BM81|ADCL4_MOUSE Arylacetamide deacetylase-like 4 OS=Mus
musculus GN=Aadacl4 PE=2 SV=2
Length = 407

Score = 35.0 bits (79), Expect = 0.17
Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 5/79 (6%)
Frame = +1

Query: 139 APDLSMLQLPRSLVTIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKL 318
A D + QLP + + +DI++D L Y + L PV + G H +L D+KL
Sbjct: 328 ADDKIIAQLPEAFLVSLHWDIIRDDVLLYKKRLEDQGVPVTWHHVEDGFHGCILLFDKKL 387

Query: 319 GS-----RMLSDIVAFIED 360
S +++ +V++I+D
Sbjct: 388 FSFPCSLNIVNAVVSYIKD 406


>sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144)
GN=lip2 PE=1 SV=1
Length = 433

Score = 34.7 bits (78), Expect = 0.22
Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
Frame = +1

Query: 25 MHNKALLVNLENSDWHWRTYLPH-GSNRDHAVCNVM-GPNAPDLSMLQLPRSLVTIAEFD 198
++ + LL++ +++ Y H G + H + +VM G N QL S + +AE D
Sbjct: 308 LYGEGLLLDHNDAEVFNSAYTQHSGLPQSHPLISVMHGDNT------QLCPSYIVVAELD 361

Query: 199 ILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSF 294
IL+D L YA+ L + VQ G H F
Sbjct: 362 ILRDEGLAYAELLQKEGVQVQTYTVLGAPHGF 393


>sp|Q5R8Y5|ADCL1_PONAB Arylacetamide deacetylase-like 1 OS=Pongo
abelii GN=AADACL1 PE=2 SV=1
Length = 408

Score = 32.0 bits (71), Expect = 1.4
Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
Frame = +1

Query: 133 PNAPDLSMLQL-PRSLVTIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGD 309
P D ++LQL P++ + E D+L+D + YA+ L A V L ++ G H +
Sbjct: 326 PLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKRLETAGVEVTLDHFEDGFHGCMIFTS 385

Query: 310 R 312
R
Sbjct: 386 R 386


tr_hit_id A9RSF8
Definition tr|A9RSF8|A9RSF8_PHYPA GLP1 GID1-like protein OS=Physcomitrella patens subsp. patens
Align length 118
Score (bit) 131.0
E-value 1.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914901|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_B09.
(472 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RSF8|A9RSF8_PHYPA GLP1 GID1-like protein OS=Physcomitrella ... 131 1e-29
tr|A9LY13|A9LY13_PHYPA Gibberellin receptor GID1-like protein OS... 131 1e-29
tr|A9RZ26|A9RZ26_PHYPA GLP2 GID1-like protein OS=Physcomitrella ... 130 3e-29
tr|A9LY14|A9LY14_PHYPA Gibberellin receptor GID1-like protein OS... 130 3e-29
tr|A9SLH6|A9SLH6_PHYPA GLP3 GID1-like protein OS=Physcomitrella ... 118 1e-25
tr|A9NNN3|A9NNN3_PICSI Putative uncharacterized protein OS=Picea... 110 4e-23
tr|B0S4S1|B0S4S1_PICGL Putative GID1-like gibberellin receptor O... 99 1e-19
tr|A9P286|A9P286_PICSI Putative uncharacterized protein OS=Picea... 99 1e-19
tr|B0S4S2|B0S4S2_PINTA Putative GID1-like gibberellin receptor O... 96 7e-19
tr|A9LY08|A9LY08_9TRAC Putative gibberellin receptor OS=Selagine... 96 1e-18
tr|A5BRG2|A5BRG2_VITVI Putative uncharacterized protein (Chromos... 95 2e-18
tr|A7PU21|A7PU21_VITVI Chromosome chr7 scaffold_31, whole genome... 94 3e-18
tr|B0S4S9|B0S4S9_SOLLC Putative GID1-like gibberellin receptor O... 94 3e-18
tr|A5ATP1|A5ATP1_VITVI Putative uncharacterized protein OS=Vitis... 94 3e-18
tr|A5Z1M8|A5Z1M8_GOSHI Gibberellic acid receptor-b OS=Gossypium ... 93 6e-18
tr|Q0ZPU9|Q0ZPU9_ACTDE CXE carboxylesterase OS=Actinidia delicio... 93 8e-18
tr|A7QR12|A7QR12_VITVI Chromosome undetermined scaffold_147, who... 92 1e-17
tr|Q0PIN1|Q0PIN1_GOSHI Gibberellic acid receptor OS=Gossypium hi... 92 1e-17
tr|B0S4S3|B0S4S3_MEDTR Putative GID1-like gibberellin receptor O... 92 2e-17
tr|A7U4T3|A7U4T3_9TRAC Putative gibberellin receptor OS=Selagine... 91 4e-17
tr|Q0ZPW9|Q0ZPW9_9ROSA CXE carboxylesterase OS=Malus pumila GN=C... 89 1e-16
tr|A5APD7|A5APD7_VITVI Putative uncharacterized protein OS=Vitis... 88 2e-16
tr|Q8H5P5|Q8H5P5_ORYSJ Os07g0643400 protein OS=Oryza sativa subs... 88 2e-16
tr|A7QR11|A7QR11_VITVI Chromosome undetermined scaffold_147, who... 88 2e-16
tr|A3BMQ5|A3BMQ5_ORYSJ Putative uncharacterized protein OS=Oryza... 88 2e-16
tr|A5Y726|A5Y726_CUCME Esterase OS=Cucumis melo PE=4 SV=1 87 4e-16
tr|B0S4S7|B0S4S7_MAIZE Putative GID1-like gibberellin receptor O... 87 5e-16
tr|B0S4T0|B0S4T0_9MAGN Putative GID1-like gibberellin receptor O... 86 9e-16
tr|A2YP77|A2YP77_ORYSI Putative uncharacterized protein OS=Oryza... 86 1e-15
tr|Q8GS14|Q8GS14_ORYSJ Carboxylesterase-like protein OS=Oryza sa... 85 2e-15

>tr|A9RSF8|A9RSF8_PHYPA GLP1 GID1-like protein OS=Physcomitrella
patens subsp. patens GN=GLP1 PE=4 SV=1
Length = 336

Score = 131 bits (330), Expect = 1e-29
Identities = 59/118 (50%), Positives = 84/118 (71%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RT ELR+ N + V++E+ DWHW+ YLP G+NRDH CN+ GPN+PDLS + LP L
Sbjct: 217 ERTSAELRLKNVPI-VSVESLDWHWKAYLPEGANRDHPSCNIFGPNSPDLSDVPLPPILN 275

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFI 354
+ DIL+DW++RY++G+ +A K VQ ++Y GIH+F +L KL S+ML D+ AFI
Sbjct: 276 IVGGLDILQDWEMRYSEGMKKAGKEVQTIFYEEGIHTFALLNQAKLASQMLLDVAAFI 333


>tr|A9LY13|A9LY13_PHYPA Gibberellin receptor GID1-like protein
OS=Physcomitrella patens PE=2 SV=1
Length = 336

Score = 131 bits (330), Expect = 1e-29
Identities = 59/118 (50%), Positives = 84/118 (71%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RT ELR+ N + V++E+ DWHW+ YLP G+NRDH CN+ GPN+PDLS + LP L
Sbjct: 217 ERTSAELRLKNVPI-VSVESLDWHWKAYLPEGANRDHPSCNIFGPNSPDLSDVPLPPILN 275

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFI 354
+ DIL+DW++RY++G+ +A K VQ ++Y GIH+F +L KL S+ML D+ AFI
Sbjct: 276 IVGGLDILQDWEMRYSEGMKKAGKEVQTIFYEEGIHTFALLNQAKLASQMLLDVAAFI 333


>tr|A9RZ26|A9RZ26_PHYPA GLP2 GID1-like protein OS=Physcomitrella
patens subsp. patens GN=GLP2 PE=4 SV=1
Length = 320

Score = 130 bits (328), Expect = 3e-29
Identities = 59/118 (50%), Positives = 84/118 (71%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RTP ELR+ N L V++E+ DW+W++YLP GSNRDH CN+ GPN+ DLS + LP L
Sbjct: 201 ERTPAELRLKNVPL-VSVESLDWYWKSYLPKGSNRDHPACNIFGPNSSDLSDVSLPPFLN 259

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFI 354
+ DIL+DW++R+A+GL +A K VQ ++Y GIH+F +L K+G +M D+ AFI
Sbjct: 260 IVGGLDILQDWEMRFAEGLQKAGKQVQTIFYEEGIHTFALLNQAKVGPKMFLDVAAFI 317


>tr|A9LY14|A9LY14_PHYPA Gibberellin receptor GID1-like protein
OS=Physcomitrella patens PE=2 SV=1
Length = 343

Score = 130 bits (328), Expect = 3e-29
Identities = 59/118 (50%), Positives = 84/118 (71%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RTP ELR+ N L V++E+ DW+W++YLP GSNRDH CN+ GPN+ DLS + LP L
Sbjct: 224 ERTPAELRLKNVPL-VSVESLDWYWKSYLPKGSNRDHPACNIFGPNSSDLSDVSLPPFLN 282

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFI 354
+ DIL+DW++R+A+GL +A K VQ ++Y GIH+F +L K+G +M D+ AFI
Sbjct: 283 IVGGLDILQDWEMRFAEGLQKAGKQVQTIFYEEGIHTFALLNQAKVGPKMFLDVAAFI 340


>tr|A9SLH6|A9SLH6_PHYPA GLP3 GID1-like protein OS=Physcomitrella
patens subsp. patens GN=GLP3 PE=4 SV=1
Length = 330

Score = 118 bits (296), Expect = 1e-25
Identities = 52/120 (43%), Positives = 81/120 (67%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RTP E+R+ N + V+++ DW+W+++LPHG+NRDH CN+ G N+PDLS + LP L+
Sbjct: 211 ERTPAEIRVRNVPM-VSVKRLDWYWKSFLPHGANRDHPACNIFGRNSPDLSDVSLPSVLI 269

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFIED 360
I DIL+DW+ RYA L +A K V++ +Y GIHSF + + +M +I+ FI++
Sbjct: 270 IIGGLDILQDWETRYADCLNRAGKDVKVFFYKNGIHSFGLFDQTHITKQMFFNIMGFIDN 329


>tr|A9NNN3|A9NNN3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 339

Score = 110 bits (275), Expect = 4e-23
Identities = 51/119 (42%), Positives = 74/119 (62%)
Frame = +1

Query: 1 DRTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLV 180
+RTP E+R+ N L+ +E +DW+WR +LP G+ RDH NV + D+S L LP SLV
Sbjct: 219 ERTPAEVRLSNGVPLITVEAADWYWRAFLPEGATRDHPAANV---TSTDISELSLPPSLV 275

Query: 181 TIAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFIE 357
+ D+L+DWQLRYA+ L + K ++L+Y IH+FHV L R L D+ F++
Sbjct: 276 VVGGLDLLQDWQLRYAEHLKKMGKQAEILFYEDAIHAFHVFPGYDLTPRFLRDLAHFLQ 334


>tr|B0S4S1|B0S4S1_PICGL Putative GID1-like gibberellin receptor
OS=Picea glauca GN=GID1 PE=2 SV=1
Length = 352

Score = 99.0 bits (245), Expect = 1e-19
Identities = 48/127 (37%), Positives = 75/127 (59%)
Frame = +1

Query: 4 RTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLVT 183
RT +E R+ K V + + DW+W +LP G+NRDH CN GP+ P L ++ P+SLV
Sbjct: 220 RTESERRLDGK-YFVTIRDRDWYWNAFLPEGANRDHPACNPFGPHGPKLDGIRFPKSLVV 278

Query: 184 IAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFIEDG 363
+A D+L+DWQ YA+ L +A K V+L++ F++L + L ++ +I F+ +G
Sbjct: 279 VAGLDLLQDWQRNYAEELRRAGKDVKLMFLDQATVGFYLLPNTDLFFYVMGEIKRFV-NG 337

Query: 364 DGKRSAE 384
DG E
Sbjct: 338 DGNSEEE 344


>tr|A9P286|A9P286_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 352

Score = 99.0 bits (245), Expect = 1e-19
Identities = 48/127 (37%), Positives = 75/127 (59%)
Frame = +1

Query: 4 RTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLVT 183
RT +E R+ K V + + DW+W +LP G+NRDH CN GP+ P L ++ P+SLV
Sbjct: 220 RTESERRLDGK-YFVTIRDRDWYWNAFLPEGANRDHPACNPFGPHGPKLDGIRFPKSLVV 278

Query: 184 IAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFIEDG 363
+A D+L+DWQ YA+ L +A K V+L++ F++L + L ++ +I F+ +G
Sbjct: 279 VAGLDLLQDWQRNYAEELRRAGKDVKLMFLDQATVGFYLLPNTDLFFYVMGEIKRFV-NG 337

Query: 364 DGKRSAE 384
DG E
Sbjct: 338 DGNSEEE 344


>tr|B0S4S2|B0S4S2_PINTA Putative GID1-like gibberellin receptor
OS=Pinus taeda GN=GID1 PE=2 SV=1
Length = 357

Score = 96.3 bits (238), Expect = 7e-19
Identities = 47/128 (36%), Positives = 76/128 (59%), Gaps = 1/128 (0%)
Frame = +1

Query: 4 RTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLVT 183
RT +E R+ K V + + DW+W +LP G+NRDH CN GP+ P L ++ P+SLV
Sbjct: 220 RTESERRLDGK-YFVTIRDRDWYWNAFLPAGANRDHPACNPFGPHGPRLEEIRFPQSLVV 278

Query: 184 IAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFIE-D 360
+A D+L+DWQ YA+ L +A K V+L++ F++L + L ++ +I F+ +
Sbjct: 279 VAGLDLLQDWQRNYAEELRRAGKEVKLMFLEQTTIGFYLLPNTDLFFNVMGEIKRFVNGN 338

Query: 361 GDGKRSAE 384
G+G + E
Sbjct: 339 GNGNGNTE 346


>tr|A9LY08|A9LY08_9TRAC Putative gibberellin receptor OS=Selaginella
moellendorffii PE=2 SV=1
Length = 371

Score = 95.5 bits (236), Expect = 1e-18
Identities = 47/122 (38%), Positives = 76/122 (62%), Gaps = 1/122 (0%)
Frame = +1

Query: 4 RTPTELRMHNKALLVNLENSDWHWRTYLPHGSNRDHAVCNVMGPNAPDLSMLQLPRSLVT 183
RT +ELR + V +++ D++W+++LP G++RDH CN+ GP++ L + LP SLV
Sbjct: 236 RTQSELRFDGQ-YFVTIKDRDFYWQSFLPAGADRDHPACNIFGPSSRSLEGVVLPPSLVA 294

Query: 184 IAEFDILKDWQLRYAQGLVQAPKPVQLLYYTGGIHSFHVLGDRKLGSRMLSDIVAFIE-D 360
+A D++KDWQL+Y +G+ A K V+LL+ F + + R++ I AFI+ D
Sbjct: 295 VAGLDMIKDWQLQYVEGMRNAGKDVELLFLEEATVGFFIFPNTGHFHRLMDKITAFIDRD 354

Query: 361 GD 366
GD
Sbjct: 355 GD 356