BP914923
Clone id YMU001_000064_D09
Library
Length 566
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000064_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAAACGGTTGGCGGGGTTTACTACGAACTGCCGGTGGAACTTCAGTATTGGACGGTCATT
GTACTGTCCCGCGGATGCGGGGCTATCAAGAAAGATTGGAAGACTGTAGTTGGTGAGAGA
CTGCATGTTGCTAAGAGAGCGAGAGAAGAGAGAAATAAGTTGGTGATCCTTTGCGGCTCT
CAAAGTGGAATATGGCACAGGGCACTGTTGTGTGGGGTCATTTTTGAAGAACCAGGATCA
AGGTGCTCCAGTCGTGCATGGCGGACTACGCCGAGAGACAGAGAGAGAGGTTTAGTTGGT
AGCTTGGGTGGCCGCCGTTTGGGTTTGTGCATGCAGATATGGTGGGTAGCATGTGGTGCG
GAAGCGGTTCGCAGCTCTCAGTTAAGAATGTGAGAGGGAGAGATTTCGTAAGTGATAAGG
GCCTGCATGGGGGATGGCCAGGTAGGTGCAATTGGTTGATAGAGTGCAAAACGCACTGGT
CGCGACGAAGATCAGAGAGAGAAAGGTAGTGGTCAAGAGAAAGGGTGACATTGGCCTTTG
CATGCATGCCGGGATGGTGAGTGGTT
■■Homology search results ■■ -
sp_hit_id P10399
Definition sp|P10399|POL1_CHICK Retrovirus-related Pol polyprotein (Fragments) OS=Gallus gallus
Align length 50
Score (bit) 31.6
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914923|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_D09.
(566 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10399|POL1_CHICK Retrovirus-related Pol polyprotein (Fragmen... 32 2.9
sp|Q9BZM4|N2DL3_HUMAN NKG2D ligand 3 OS=Homo sapiens GN=ULBP3 PE... 31 4.9

>sp|P10399|POL1_CHICK Retrovirus-related Pol polyprotein (Fragments)
OS=Gallus gallus GN=POL PE=4 SV=1
Length = 246

Score = 31.6 bits (70), Expect = 2.9
Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
Frame = -2

Query: 451 LHLPGHPPCRPLSLTKSLPLTFLTESCEPLPH-HMLPTISACTNPNGGHP 305
LH H R LS T S+P+ E + PH + P +SA NP G P
Sbjct: 157 LHSTLHLGARALSRTCSIPMAVAREVVQACPHCNSAPALSAGVNPRGIAP 206


>sp|Q9BZM4|N2DL3_HUMAN NKG2D ligand 3 OS=Homo sapiens GN=ULBP3 PE=1
SV=1
Length = 244

Score = 30.8 bits (68), Expect = 4.9
Identities = 16/42 (38%), Positives = 18/42 (42%)
Frame = +3

Query: 309 WPPFGFVHADMVGSMWCGSGSQLSVKNVRGRDFVSDKGLHGG 434
W F +H G WC SQ+ KN D SDK L G
Sbjct: 35 WYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMG 76


tr_hit_id Q2FUJ7
Definition tr|Q2FUJ7|Q2FUJ7_METHJ PKD OS=Methanospirillum hungatei (strain JF-1 / DSM 864)
Align length 43
Score (bit) 34.3
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914923|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_D09.
(566 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2FUJ7|Q2FUJ7_METHJ PKD OS=Methanospirillum hungatei (strain ... 34 4.9
tr|B7RYH4|B7RYH4_9GAMM Amino acid/peptide transporter subfamily ... 34 6.4
tr|B0P6T9|B0P6T9_9FIRM Putative uncharacterized protein OS=Anaer... 33 8.3

>tr|Q2FUJ7|Q2FUJ7_METHJ PKD OS=Methanospirillum hungatei (strain
JF-1 / DSM 864) GN=Mhun_3126 PE=3 SV=1
Length = 1162

Score = 34.3 bits (77), Expect = 4.9
Identities = 14/43 (32%), Positives = 22/43 (51%)
Frame = +3

Query: 309 WPPFGFVHADMVGSMWCGSGSQLSVKNVRGRDFVSDKGLHGGW 437
W +G D +G + +G Q N+R R F + + +HGGW
Sbjct: 354 WAYYGATTTDRLGLVGWTTGGQAYYDNIRVRKFTNTRPVHGGW 396


>tr|B7RYH4|B7RYH4_9GAMM Amino acid/peptide transporter subfamily
protein OS=marine gamma proteobacterium HTCC2148
GN=GPB2148_1476 PE=4 SV=1
Length = 516

Score = 33.9 bits (76), Expect = 6.4
Identities = 20/68 (29%), Positives = 36/68 (52%)
Frame = +1

Query: 34 VELQYWTVIVLSRGCGAIKKDWKTVVGERLHVAKRAREERNKLVILCGSQSGIWHRALLC 213
+++ Y+++ ++ G G +K + T+VG RL+ A R + + G G + ALLC
Sbjct: 125 LQVFYFSLALIVVGVGFLKPNISTIVG-RLYSADDPRRDSGFTIFYMGINIGAFAAALLC 183

Query: 214 GVIFEEPG 237
G + E G
Sbjct: 184 GYLGETLG 191


>tr|B0P6T9|B0P6T9_9FIRM Putative uncharacterized protein
OS=Anaerotruncus colihominis DSM 17241 GN=ANACOL_00466
PE=4 SV=1
Length = 97

Score = 33.5 bits (75), Expect = 8.3
Identities = 13/25 (52%), Positives = 15/25 (60%)
Frame = +3

Query: 321 GFVHADMVGSMWCGSGSQLSVKNVR 395
GF +AD GS+WCGSG S R
Sbjct: 3 GFFYADFAGSLWCGSGGDNSAVRAR 27