BP914936
Clone id YMU001_000064_F01
Library
Length 432
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000064_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATGAGAAAATACGGGTTGGTAAATTGCATATGGCGCAACGGCACACTTTGAACAAGAGCT
CCCACAATAATTCCACATCCATGCCCCCTTCCGGTAATCGAACTCGGGTCCTTCTGACCA
CAATTACACTACTTGACCCATAATTAGGCAGCCGATTACACTAATTACCCCTACCGTAAT
CAGGATATGGAAATCCTCTCTATAATCTTCGTTTGCACCTCAATAATCCTCAGCTCAGAG
ATTGCCAATTCCTGCAGCCTCAAATTGCATGCCTGCATCCATCCAAAGCTCTCTTAGCCC
GCACTCTTTCATCATCCTCTCCCATTGCCTCGCATACGCAGGAAGCCATTTCTTGAGCGT
CGGCCCCGGGCCATGAACCACAAAGTCTCCTGGTTGAAACAAGTACCCTTCTCCCGCAGG
GTATCCATAAGC
■■Homology search results ■■ -
sp_hit_id Q6MDC0
Definition sp|Q6MDC0|SYFA_PARUW Phenylalanyl-tRNA synthetase alpha chain OS=Protochlamydia amoebophila (strain UWE25)
Align length 55
Score (bit) 31.6
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914936|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_F01.
(432 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6MDC0|SYFA_PARUW Phenylalanyl-tRNA synthetase alpha chain OS... 32 1.4
sp|Q6MQU3|SYL_BDEBA Leucyl-tRNA synthetase OS=Bdellovibrio bacte... 29 9.6
sp|Q0DEC8|SSY1_ORYSJ Soluble starch synthase 1, chloroplastic/am... 29 9.6
sp|A2Y9M4|SSY1_ORYSI Soluble starch synthase 1, chloroplastic/am... 29 9.6
sp|Q8YBA4|NORD_BRUME Protein norD OS=Brucella melitensis GN=norD... 29 9.6

>sp|Q6MDC0|SYFA_PARUW Phenylalanyl-tRNA synthetase alpha chain
OS=Protochlamydia amoebophila (strain UWE25) GN=pheS
PE=3 SV=1
Length = 346

Score = 31.6 bits (70), Expect = 1.4
Identities = 17/55 (30%), Positives = 27/55 (49%)
Frame = +3

Query: 186 YGNPLYNLRLHLNNPQLRDCQFLQPQIACLHPSKALLARTLSSSSPIASHTQEAI 350
Y +P LR H +N Q R + +P I + P K T+++ S + H EA+
Sbjct: 164 YISPHVLLRTHTSNIQARAMELNRPPIRIIAPGKVYRNETITARSHVFFHQVEAV 218


>sp|Q6MQU3|SYL_BDEBA Leucyl-tRNA synthetase OS=Bdellovibrio
bacteriovorus GN=leuS PE=3 SV=1
Length = 796

Score = 28.9 bits (63), Expect = 9.6
Identities = 17/42 (40%), Positives = 23/42 (54%)
Frame = -1

Query: 420 PAGEGYLFQPGDFVVHGPGPTLKKWLPAYARQWERMMKECGL 295
P E Y + P D V GP T+ L YAR W +++ +CGL
Sbjct: 508 PEAEKY-WMPVDLYVGGPEHTVGHLL--YARFWTKVLFDCGL 546


>sp|Q0DEC8|SSY1_ORYSJ Soluble starch synthase 1,
chloroplastic/amyloplastic OS=Oryza sativa subsp.
japonica GN=Os06g0160700 PE=1 SV=1
Length = 641

Score = 28.9 bits (63), Expect = 9.6
Identities = 17/51 (33%), Positives = 26/51 (50%)
Frame = +1

Query: 52 TRAPTIIPHPCPLPVIELGSF*PQLHYLTHN*AADYTNYPYRNQDMEILSI 204
T++P P P PLP +G P L LT + + D T + Q+ EI+ +
Sbjct: 74 TQSPAPAPTPPPLPDSGVGEIEPDLEGLTED-SIDKTIFVASEQESEIMDV 123


>sp|A2Y9M4|SSY1_ORYSI Soluble starch synthase 1,
chloroplastic/amyloplastic OS=Oryza sativa subsp. indica
GN=OsI_021017 PE=2 SV=1
Length = 641

Score = 28.9 bits (63), Expect = 9.6
Identities = 17/51 (33%), Positives = 26/51 (50%)
Frame = +1

Query: 52 TRAPTIIPHPCPLPVIELGSF*PQLHYLTHN*AADYTNYPYRNQDMEILSI 204
T++P P P PLP +G P L LT + + D T + Q+ EI+ +
Sbjct: 74 TQSPAPAPTPPPLPDSGVGEIEPDLEGLTED-SIDKTIFVASEQESEIMDV 123


>sp|Q8YBA4|NORD_BRUME Protein norD OS=Brucella melitensis GN=norD
PE=3 SV=1
Length = 633

Score = 28.9 bits (63), Expect = 9.6
Identities = 10/15 (66%), Positives = 14/15 (93%)
Frame = -1

Query: 108 PEFDYRKGAWMWNYC 64
PE+DYRKGA++ N+C
Sbjct: 347 PEWDYRKGAYLPNHC 361


tr_hit_id Q8Y305
Definition tr|Q8Y305|Q8Y305_RALSO Probable lipoprotein OS=Ralstonia solanacearum
Align length 47
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914936|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_F01.
(432 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8Y305|Q8Y305_RALSO Probable lipoprotein OS=Ralstonia solanac... 33 5.4
tr|A4R754|A4R754_MAGGR Putative uncharacterized protein OS=Magna... 33 5.5
tr|B5SED6|B5SED6_RALSO Lipoprotein OS=Ralstonia solanacearum IPO... 33 7.1
tr|B5S7Q1|B5S7Q1_RALSO Lipoprotein OS=Ralstonia solanacearum GN=... 33 7.1

>tr|Q8Y305|Q8Y305_RALSO Probable lipoprotein OS=Ralstonia
solanacearum GN=RSc0176 PE=4 SV=1
Length = 299

Score = 33.5 bits (75), Expect = 5.4
Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
Frame = -1

Query: 375 HGPGPTLKKWLPAYARQWERMMKECGL-RELWMDAGMQFEAAGIGNL 238
H PT+ +WL AYA QWE E G R+ ++DA + I NL
Sbjct: 205 HPDKPTVMQWLTAYADQWEHPPGERGARRDAYLDASVDVSVT-IANL 250


>tr|A4R754|A4R754_MAGGR Putative uncharacterized protein
OS=Magnaporthe grisea GN=MGG_03355 PE=4 SV=1
Length = 92

Score = 33.5 bits (75), Expect = 5.5
Identities = 16/38 (42%), Positives = 19/38 (50%)
Frame = -3

Query: 421 PCGRRVLVSTRRLCGSWPGADAQEMASCVCEAMGEDDE 308
P G RV T RLCG W A+A + +C A D E
Sbjct: 50 PDGSRVADGTTRLCGKWYTAEADDSCVVICMASSIDAE 87


>tr|B5SED6|B5SED6_RALSO Lipoprotein OS=Ralstonia solanacearum
IPO1609 GN=RSIPO_00230 PE=4 SV=1
Length = 324

Score = 33.1 bits (74), Expect = 7.1
Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
Frame = -1

Query: 375 HGPGPTLKKWLPAYARQWERMMKECGL-RELWMDAGM 268
H PT+ +WL AYA QWE E G R+ ++DA +
Sbjct: 229 HPDKPTVMQWLTAYADQWEHPPGERGARRDAYLDASV 265


>tr|B5S7Q1|B5S7Q1_RALSO Lipoprotein OS=Ralstonia solanacearum
GN=RSMK03949 PE=4 SV=1
Length = 324

Score = 33.1 bits (74), Expect = 7.1
Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
Frame = -1

Query: 375 HGPGPTLKKWLPAYARQWERMMKECGL-RELWMDAGM 268
H PT+ +WL AYA QWE E G R+ ++DA +
Sbjct: 229 HPDKPTVMQWLTAYADQWEHPPGERGARRDAYLDASV 265