BP914955
Clone id YMU001_000064_G11
Library
Length 385
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000064_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATGTGCATGTCTTTTGTAACTATTGAAACCATGTATTTTCTCAATAATGACATTGTCTT
GTACTATTACATTGCAAGCTTACATCAAGTGATTGCATATGATGTATATAATGTCAGATA
CTTTCGTCAATTACCTGCGTCCAATTACTTTTGTCAGTTTGTATCTTGATCTAAACAATA
CTCTAAATGATGGAGTACTGTATATGTCTTATGGTGACTACTTGGGTCTATCTTGCACTT
TATTTCAAAGGTGAATCTGTGTTATCTTGGATTCATTTAGGTTTACTCTATTATTGAAAC
ATTCAATATGGTTGATGGGTGGCAGGGCATTTAGCCTTGCCACCCAAAATTTTTTACTCT
CGTGGCGCTGCTATATAAGGCTCTA
■■Homology search results ■■ -
sp_hit_id Q8IM46
Definition sp|Q8IM46|YPF02_PLAF7 Uncharacterized protein PF14_0045 OS=Plasmodium falciparum (isolate 3D7)
Align length 98
Score (bit) 30.4
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914955|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_G11.
(385 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8IM46|YPF02_PLAF7 Uncharacterized protein PF14_0045 OS=Plasm... 30 2.8
sp|A1DM82|MED18_NEOFI Mediator of RNA polymerase II transcriptio... 30 4.9
sp|Q4WNC6|MED18_ASPFU Mediator of RNA polymerase II transcriptio... 30 4.9
sp|P47360|PGSA_MYCGE CDP-diacylglycerol--glycerol-3-phosphate 3-... 29 8.4
sp|P52189|IRK4_MOUSE Inward rectifier potassium channel 4 OS=Mus... 29 8.4

>sp|Q8IM46|YPF02_PLAF7 Uncharacterized protein PF14_0045
OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0045 PE=4
SV=1
Length = 964

Score = 30.4 bits (67), Expect = 2.8
Identities = 23/98 (23%), Positives = 46/98 (46%), Gaps = 2/98 (2%)
Frame = +3

Query: 33 CIFSIMTLSCTITLQAYIK*LHMMYIMSDTFVNYLRPITFVSLYLDLNNTLNDGVLYMSY 212
C+F +T + + + +H + DT+V+ LR F + ++DL +T + +Y
Sbjct: 23 CLFVFVTWALFLNNNGILYPVHCLKSAGDTYVDTLRGSNFNNEFIDLLSTRDICNTIKNY 82

Query: 213 GDYLGLSCTLFQR*ICV--ILDSFRFTLLLKHSIWLMG 320
+ C + + + I++S TLL H+I + G
Sbjct: 83 ITREQIKCAISYDVLNISNIINSLEKTLLRDHNIIING 120


>sp|A1DM82|MED18_NEOFI Mediator of RNA polymerase II transcription
subunit 18 OS=Neosartorya fischeri (strain ATCC 1020 /
DSM 3700 / NRRL 181) GN=srb5 PE=3 SV=1
Length = 268

Score = 29.6 bits (65), Expect = 4.9
Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
Frame = +2

Query: 11 SFVT---IETMYFLNNDIVLYYYIASLHQVIAYDVYNVRYFRQLPASN 145
+FVT +E F++NDIV++ LH+V+ Y + RQLPA N
Sbjct: 165 NFVTEYAVEGDIFIHNDIVIF-----LHRVLHYPTESQEPRRQLPALN 207


>sp|Q4WNC6|MED18_ASPFU Mediator of RNA polymerase II transcription
subunit 18 OS=Aspergillus fumigatus GN=srb5 PE=3 SV=1
Length = 268

Score = 29.6 bits (65), Expect = 4.9
Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
Frame = +2

Query: 11 SFVT---IETMYFLNNDIVLYYYIASLHQVIAYDVYNVRYFRQLPASN 145
+FVT +E F++NDIV++ LH+V+ Y + RQLPA N
Sbjct: 165 NFVTEYAVEGDIFIHNDIVIF-----LHRVLHYPTESQEPRRQLPALN 207


>sp|P47360|PGSA_MYCGE CDP-diacylglycerol--glycerol-3-phosphate
3-phosphatidyltransferase OS=Mycoplasma genitalium
GN=pgsA PE=3 SV=1
Length = 236

Score = 28.9 bits (63), Expect = 8.4
Identities = 11/29 (37%), Positives = 21/29 (72%)
Frame = +2

Query: 59 LYYYIASLHQVIAYDVYNVRYFRQLPASN 145
L YY+A++ + ++ VYN++ ++QL A N
Sbjct: 205 LPYYLAAVFSIWSFIVYNIQIYQQLKAYN 233


>sp|P52189|IRK4_MOUSE Inward rectifier potassium channel 4 OS=Mus
musculus GN=Kcnj4 PE=2 SV=1
Length = 445

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
Frame = +1

Query: 217 TTWVYLALYFKGESVLSWIHLGLLYY*NIQYG*WVA---GHLALPPKI 351
T W Y+ + F ++SW+ GLL++ W+A G L P +
Sbjct: 53 TRWRYMLMIFSAAFLVSWLFFGLLFW-------WIAFFHGDLEASPSV 93


tr_hit_id Q3ERF1
Definition tr|Q3ERF1|Q3ERF1_BACTI Sensor protein OS=Bacillus thuringiensis serovar israelensis ATCC 35646
Align length 89
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914955|Adiantum capillus-veneris mRNA, clone:
YMU001_000064_G11.
(385 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q3ERF1|Q3ERF1_BACTI Sensor protein OS=Bacillus thuringiensis ... 35 1.9
tr|B7IRH3|B7IRH3_BACCE Sporulation kinase OS=Bacillus cereus G98... 35 1.9
tr|Q81AN4|Q81AN4_BACCR Sensor protein OS=Bacillus cereus (strain... 35 2.5
tr|B7HAP9|B7HAP9_BACCE Sporulation kinase OS=Bacillus cereus B42... 35 2.5
tr|B5UL31|B5UL31_BACCE Sporulation kinase OS=Bacillus cereus AH1... 35 2.5
tr|Q1LUW8|Q1LUW8_DANRE Novel protein OS=Danio rerio GN=si:ch211-... 34 3.2
tr|Q4MHU8|Q4MHU8_BACCE Sensor protein OS=Bacillus cereus G9241 G... 34 3.2
tr|Q58EA7|Q58EA7_DANRE Zgc:113361 OS=Danio rerio GN=zgc:113361 P... 33 5.5
tr|Q1LUX1|Q1LUX1_DANRE Novel protein (Zgc:113361) OS=Danio rerio... 33 5.5
tr|Q1LUW7|Q1LUW7_DANRE Novel protein OS=Danio rerio GN=si:ch211-... 33 5.5
tr|Q1L8I9|Q1L8I9_DANRE Novel protein OS=Danio rerio GN=si:ch211-... 33 5.5
tr|Q1L8I8|Q1L8I8_DANRE Si:ch211-244h7.6 protein OS=Danio rerio G... 33 5.5
tr|Q1L8I5|Q1L8I5_DANRE Novel protein OS=Danio rerio GN=CH211-244... 33 5.5
tr|A8BU57|A8BU57_GIALA Putative uncharacterized protein OS=Giard... 33 5.5
tr|A4VE11|A4VE11_TETTH Putative uncharacterized protein OS=Tetra... 33 7.2

>tr|Q3ERF1|Q3ERF1_BACTI Sensor protein OS=Bacillus thuringiensis
serovar israelensis ATCC 35646 GN=RBTH_03037 PE=4 SV=1
Length = 443

Score = 35.0 bits (79), Expect = 1.9
Identities = 28/89 (31%), Positives = 44/89 (49%)
Frame = +3

Query: 36 IFSIMTLSCTITLQAYIK*LHMMYIMSDTFVNYLRPITFVSLYLDLNNTLNDGVLYMSYG 215
+FSI++ I + LH+ +I F+ PI V LY + N + G+LY+SY
Sbjct: 54 LFSILSSIAIIFCMTFPFHLHVGFIYDLRFI----PIILVFLYGNTKNIIFIGILYLSYR 109

Query: 216 DYLGLSCTLFQR*ICVILDSFRFTLLLKH 302
YLG + L I I+ F T+L ++
Sbjct: 110 FYLGGNGVLPSFIIFTII--FGITMLFRY 136


>tr|B7IRH3|B7IRH3_BACCE Sporulation kinase OS=Bacillus cereus G9842
GN=BCG9842_B1681 PE=4 SV=1
Length = 426

Score = 35.0 bits (79), Expect = 1.9
Identities = 28/89 (31%), Positives = 44/89 (49%)
Frame = +3

Query: 36 IFSIMTLSCTITLQAYIK*LHMMYIMSDTFVNYLRPITFVSLYLDLNNTLNDGVLYMSYG 215
+FSI++ I + LH+ +I F+ PI V LY + N + G+LY+SY
Sbjct: 37 LFSILSSIAIIFCMTFPFHLHVGFIYDLRFI----PIILVFLYGNTKNIIFIGILYLSYR 92

Query: 216 DYLGLSCTLFQR*ICVILDSFRFTLLLKH 302
YLG + L I I+ F T+L ++
Sbjct: 93 FYLGGNGVLPSFIIFTII--FGITMLFRY 119


>tr|Q81AN4|Q81AN4_BACCR Sensor protein OS=Bacillus cereus (strain
ATCC 14579 / DSM 31) GN=BC_3528 PE=4 SV=1
Length = 417

Score = 34.7 bits (78), Expect = 2.5
Identities = 28/89 (31%), Positives = 44/89 (49%)
Frame = +3

Query: 36 IFSIMTLSCTITLQAYIK*LHMMYIMSDTFVNYLRPITFVSLYLDLNNTLNDGVLYMSYG 215
+FSI++ I + LH+ +I F+ PI V LY + N + G+LY+SY
Sbjct: 37 LFSILSSIAIIFCMTFPFHLHVGFIYDLRFI----PIILVFLYGNTKNIVFIGILYLSYR 92

Query: 216 DYLGLSCTLFQR*ICVILDSFRFTLLLKH 302
YLG + L I I+ F T+L ++
Sbjct: 93 FYLGGNGVLPSFIIFTII--FGITMLFRY 119


>tr|B7HAP9|B7HAP9_BACCE Sporulation kinase OS=Bacillus cereus B4264
GN=BCB4264_A3635 PE=4 SV=1
Length = 417

Score = 34.7 bits (78), Expect = 2.5
Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
Frame = +3

Query: 36 IFSIMTLSCTITLQAYIK*LHMMYIMSDTFVNYLRPITFVSLYLDLNNTLNDGVLYMSYG 215
+FSI++ I + LH+ +I F+ PI V LY + N + G+LY+SY
Sbjct: 37 LFSILSSIAIIFCMTFPFHLHVGFIYDLRFI----PIILVFLYGNTKNIVFIGILYLSYR 92

Query: 216 DYLG----LSCTLFQR*ICVILDSFRFTL 290
YLG L + I VI FR+ L
Sbjct: 93 FYLGGNGVLPSFIIFTIISVITMLFRYLL 121


>tr|B5UL31|B5UL31_BACCE Sporulation kinase OS=Bacillus cereus AH1134
GN=BCAH1134_3595 PE=4 SV=1
Length = 417

Score = 34.7 bits (78), Expect = 2.5
Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
Frame = +3

Query: 36 IFSIMTLSCTITLQAYIK*LHMMYIMSDTFVNYLRPITFVSLYLDLNNTLNDGVLYMSYG 215
+FSI++ I + LH+ +I F+ PI V LY + N + G+LY+SY
Sbjct: 37 LFSILSSIAIIFCMTFPFHLHVGFIYDLRFI----PIILVFLYGNTKNIVFIGILYLSYR 92

Query: 216 DYLG----LSCTLFQR*ICVILDSFRFTL 290
YLG L + I VI FR+ L
Sbjct: 93 FYLGGNGVLPSFIIFTIISVITMLFRYLL 121


>tr|Q1LUW8|Q1LUW8_DANRE Novel protein OS=Danio rerio
GN=si:ch211-244h7.6 PE=3 SV=1
Length = 370

Score = 34.3 bits (77), Expect = 3.2
Identities = 13/36 (36%), Positives = 22/36 (61%)
Frame = +1

Query: 187 MMEYCICLMVTTWVYLALYFKGESVLSWIHLGLLYY 294
++++ L+ T W ++ LYF LSW+ GLL+Y
Sbjct: 46 VLDFWTTLVETRWRFILLYFVASYTLSWLIFGLLWY 81


>tr|Q4MHU8|Q4MHU8_BACCE Sensor protein OS=Bacillus cereus G9241
GN=BCE_G9241_3469 PE=4 SV=1
Length = 417

Score = 34.3 bits (77), Expect = 3.2
Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 4/89 (4%)
Frame = +3

Query: 36 IFSIMTLSCTITLQAYIK*LHMMYIMSDTFVNYLRPITFVSLYLDLNNTLNDGVLYMSYG 215
+FSI++ I + LH +I F+ PI V LY + N + G+LY+SY
Sbjct: 37 LFSILSSVAIIFCMTFPFHLHAGFIYDLRFI----PIILVFLYGNTKNIVFIGILYLSYR 92

Query: 216 DYLG----LSCTLFQR*ICVILDSFRFTL 290
YLG L + I VI FR+ L
Sbjct: 93 FYLGGNGVLPSFIIFTIISVITMFFRYVL 121


>tr|Q58EA7|Q58EA7_DANRE Zgc:113361 OS=Danio rerio GN=zgc:113361 PE=2
SV=1
Length = 370

Score = 33.5 bits (75), Expect = 5.5
Identities = 13/36 (36%), Positives = 21/36 (58%)
Frame = +1

Query: 187 MMEYCICLMVTTWVYLALYFKGESVLSWIHLGLLYY 294
++++ L+ T W ++ LYF LSW GLL+Y
Sbjct: 46 VLDFWTTLVETRWRFILLYFVASFTLSWFIFGLLWY 81


>tr|Q1LUX1|Q1LUX1_DANRE Novel protein (Zgc:113361) OS=Danio rerio
GN=CH211-241L24.3 PE=3 SV=1
Length = 370

Score = 33.5 bits (75), Expect = 5.5
Identities = 13/36 (36%), Positives = 21/36 (58%)
Frame = +1

Query: 187 MMEYCICLMVTTWVYLALYFKGESVLSWIHLGLLYY 294
++++ L+ T W ++ LYF LSW GLL+Y
Sbjct: 46 VLDFWTTLVETRWRFILLYFVASFTLSWFIFGLLWY 81


>tr|Q1LUW7|Q1LUW7_DANRE Novel protein OS=Danio rerio
GN=si:ch211-244h7.8 PE=3 SV=1
Length = 370

Score = 33.5 bits (75), Expect = 5.5
Identities = 13/36 (36%), Positives = 21/36 (58%)
Frame = +1

Query: 187 MMEYCICLMVTTWVYLALYFKGESVLSWIHLGLLYY 294
++++ L+ T W ++ LYF LSW GLL+Y
Sbjct: 46 VLDFWTTLVETRWRFIILYFVASYTLSWFIFGLLWY 81