BP914972
Clone id YMU001_000065_A08
Library
Length 449
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000065_A08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACATTATTTTGAACGCTCATACAAGCATGAAGATGTTTCTCTATGGTGCTGTAGGCGATC
GATATACATTGGATCACTGTTGAGCTAGCAAGGTAGCTGCAAACAATCCGACGACTTCAG
CTGAGATGCAGCAGTCCAAAGATGTTTCTCTATGGTGCTTGAGGTGATCAATATGCATCG
GTACATTCTGACCTGAGCCTCAAACAACAGGTCATGGGGGTACCCACAAAGCTCATTTGG
GGGATTATGGCTTTATACAAATCAGTTGCGTGTCAGATCTATCATAAGGAAGAATTTTTG
CTGCTTGAAGCAAAAAAATAAAAATAACAATTGAATGGAGTGGAATCTAAGTATGATGTT
ATTGGGAAGAATGGAACATGGTCTTTGTATGACTTTACGTCCTTGCAAAATGGTCATAGG
TACTAAGTGGGCTTTCAAGTTGGAACATA
■■Homology search results ■■ -
sp_hit_id Q68X99
Definition sp|Q68X99|CYB_RICTY Cytochrome b OS=Rickettsia typhi
Align length 31
Score (bit) 32.3
E-value 0.95
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914972|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_A08.
(449 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q68X99|CYB_RICTY Cytochrome b OS=Rickettsia typhi GN=petB PE=... 32 0.95
sp|O54070|CYB_RICPR Cytochrome b OS=Rickettsia prowazekii GN=pet... 32 0.95
sp|Q4UJM4|CYB_RICFE Cytochrome b OS=Rickettsia felis GN=petB PE=... 32 1.2
sp|Q92IR1|CYB_RICCN Cytochrome b OS=Rickettsia conorii GN=petB P... 32 1.2
sp|Q1RIA4|CYB_RICBR Cytochrome b OS=Rickettsia bellii (strain RM... 32 1.2

>sp|Q68X99|CYB_RICTY Cytochrome b OS=Rickettsia typhi GN=petB PE=3
SV=1
Length = 398

Score = 32.3 bits (72), Expect = 0.95
Identities = 15/31 (48%), Positives = 17/31 (54%)
Frame = -1

Query: 401 DVKSYKDHVPFFPITSYLDSTPFNCYFYFFA 309
DVKS KD +PF P + D F YF FA
Sbjct: 226 DVKSTKDTIPFHPYYTVKDFVGFGVYFIIFA 256


>sp|O54070|CYB_RICPR Cytochrome b OS=Rickettsia prowazekii GN=petB
PE=3 SV=1
Length = 398

Score = 32.3 bits (72), Expect = 0.95
Identities = 15/31 (48%), Positives = 17/31 (54%)
Frame = -1

Query: 401 DVKSYKDHVPFFPITSYLDSTPFNCYFYFFA 309
DVKS KD +PF P + D F YF FA
Sbjct: 226 DVKSTKDTIPFHPYYTVKDFVGFGVYFIIFA 256


>sp|Q4UJM4|CYB_RICFE Cytochrome b OS=Rickettsia felis GN=petB PE=3
SV=1
Length = 398

Score = 32.0 bits (71), Expect = 1.2
Identities = 15/31 (48%), Positives = 17/31 (54%)
Frame = -1

Query: 401 DVKSYKDHVPFFPITSYLDSTPFNCYFYFFA 309
DVKS KD +PF P + D F YF FA
Sbjct: 226 DVKSPKDTIPFHPYYTVKDFVGFGVYFIIFA 256


>sp|Q92IR1|CYB_RICCN Cytochrome b OS=Rickettsia conorii GN=petB PE=3
SV=1
Length = 398

Score = 32.0 bits (71), Expect = 1.2
Identities = 15/31 (48%), Positives = 17/31 (54%)
Frame = -1

Query: 401 DVKSYKDHVPFFPITSYLDSTPFNCYFYFFA 309
DVKS KD +PF P + D F YF FA
Sbjct: 226 DVKSPKDTIPFHPYYTVKDFVGFGVYFIIFA 256


>sp|Q1RIA4|CYB_RICBR Cytochrome b OS=Rickettsia bellii (strain
RML369-C) GN=petB PE=3 SV=1
Length = 400

Score = 32.0 bits (71), Expect = 1.2
Identities = 15/31 (48%), Positives = 17/31 (54%)
Frame = -1

Query: 401 DVKSYKDHVPFFPITSYLDSTPFNCYFYFFA 309
DVKS KD +PF P + D F YF FA
Sbjct: 228 DVKSPKDTIPFHPYYTVKDFVGFGVYFIIFA 258


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914972|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_A08.
(449 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******