BP914979
Clone id YMU001_000065_B03
Library
Length 352
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000065_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGAGGCCAACAAGAAGGAGCTGGCCCACTGATGGGCAATCTCCACATCCACTTCTCTTC
ATTTCTAATCAACCCAATCACACACACTAATGATTGAAAGACGCACACAACACTAATCAT
ATCATGCAGCACACTAATCGCAAGCACACACACATAGATCTATTAAGCGCCACACTCCAA
TCAAACCTACATGCACACATAAGCAAGAGAGGTCAATCACACAAGATTTGAGAGGGATTA
ACCACTAATTAGCTAAGATCTATCTAATCAAAGCATCATAGGCAATCATAAGAAGCATGA
GAGAGGCGTAGTGAAAGAGAATTAAGCATTGATTAGTGTTAACCAAGCTACA
■■Homology search results ■■ -
sp_hit_id P05623
Definition sp|P05623|A70A_DROME Accessory gland-specific peptide 70A OS=Drosophila melanogaster
Align length 40
Score (bit) 29.6
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914979|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_B03.
(352 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P05623|A70A_DROME Accessory gland-specific peptide 70A OS=Dro... 30 4.8
sp|A4SGJ6|SYA_PROVI Alanyl-tRNA synthetase OS=Prosthecochloris v... 29 6.3
sp|P04931|ARP_PLAFA Asparagine-rich protein (Fragment) OS=Plasmo... 29 8.2
sp|O18417|A70A_DROSE Accessory gland-specific peptide 70A OS=Dro... 29 8.2

>sp|P05623|A70A_DROME Accessory gland-specific peptide 70A
OS=Drosophila melanogaster GN=Acp70A PE=1 SV=1
Length = 55

Score = 29.6 bits (65), Expect = 4.8
Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
Frame = -2

Query: 117 ISVVCVFQSLVCVIGLIRNEEKWMW-RLPISGPAPSCWPQ 1
+ + +F LVCV+GL+++ E W W R P P PS P+
Sbjct: 1 MKTLALFLVLVCVLGLVQSWE-WPWNRKPTKFPIPSPNPR 39


>sp|A4SGJ6|SYA_PROVI Alanyl-tRNA synthetase OS=Prosthecochloris
vibrioformis (strain DSM 265) (strain DSM 265) GN=alaS
PE=3 SV=2
Length = 885

Score = 29.3 bits (64), Expect = 6.3
Identities = 13/31 (41%), Positives = 18/31 (58%)
Frame = +1

Query: 121 IMQHTNRKHTHIDLLSATLQSNLHAHISKRG 213
+ Q T R HT LL A L+ L AH+ ++G
Sbjct: 560 LRQATERNHTATHLLHAVLRHTLGAHVQQKG 590


>sp|P04931|ARP_PLAFA Asparagine-rich protein (Fragment)
OS=Plasmodium falciparum PE=2 SV=2
Length = 537

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
Frame = +1

Query: 106 HNTNHIMQHT-NRKHTHIDLLSATLQSNLHAHISKRGQSHKI*EGLTTN 249
HN N+ M H N +I+ L + + N HAH+ ++ E T N
Sbjct: 297 HNMNNNMNHNMNNNMNNINSLDSDMSPNYHAHVKMSMMNYNNNESNTAN 345


>sp|O18417|A70A_DROSE Accessory gland-specific peptide 70A
OS=Drosophila sechellia GN=Acp70A PE=2 SV=1
Length = 55

Score = 28.9 bits (63), Expect = 8.2
Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
Frame = -2

Query: 117 ISVVCVFQSLVCVIGLIRNEEKWMW-RLPISGPAPSCWPQ 1
+ + VF LVC++GL+++ E W W R P P PS P+
Sbjct: 1 MKTLSVFLVLVCLLGLVQSWE-WPWNRQPTRYPIPSPNPR 39


tr_hit_id B4JCR8
Definition tr|B4JCR8|B4JCR8_DROGR GH11685 OS=Drosophila grimshawi
Align length 33
Score (bit) 33.1
E-value 7.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914979|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_B03.
(352 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4JCR8|B4JCR8_DROGR GH11685 OS=Drosophila grimshawi GN=GH1168... 33 7.0
tr|B7K1L6|B7K1L6_SYNP8 Putative uncharacterized protein OS=Synec... 33 9.1
tr|B4C0V3|B4C0V3_9CHRO HEAT domain containing protein OS=Cyanoth... 33 9.1

>tr|B4JCR8|B4JCR8_DROGR GH11685 OS=Drosophila grimshawi GN=GH11685
PE=4 SV=1
Length = 504

Score = 33.1 bits (74), Expect = 7.0
Identities = 15/33 (45%), Positives = 22/33 (66%)
Frame = +1

Query: 94 LKDAHNTNHIMQHTNRKHTHIDLLSATLQSNLH 192
L D HN N +Q + RK T+ID L A L++++H
Sbjct: 439 LYDIHNLNVELQASKRKETYIDDLQAVLKASIH 471


>tr|B7K1L6|B7K1L6_SYNP8 Putative uncharacterized protein
OS=Synechococcus sp. (strain PCC 8801 / RF-1)
GN=PCC8801_3596 PE=4 SV=1
Length = 1635

Score = 32.7 bits (73), Expect = 9.1
Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
Frame = +1

Query: 61 ISNQPNHT-H**LKDAHNTNHIMQHTNRKHTHIDLLSATLQSNLHAHI 201
I +Q N T H K HN N + Q T RKHT +DLL + + I
Sbjct: 889 IQSQDNSTTHSYYKYRHNFNDLSQITRRKHTELDLLLKEISHQIRQRI 936


>tr|B4C0V3|B4C0V3_9CHRO HEAT domain containing protein OS=Cyanothece
sp. PCC 8802 GN=Cyan8802DRAFT_2792 PE=4 SV=1
Length = 1635

Score = 32.7 bits (73), Expect = 9.1
Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
Frame = +1

Query: 61 ISNQPNHT-H**LKDAHNTNHIMQHTNRKHTHIDLLSATLQSNLHAHI 201
I +Q N T H K HN N + Q T RKHT +DLL + + I
Sbjct: 889 IQSQDNSTTHSYYKYRHNFNDLSQITRRKHTELDLLLKEISHQIRQRI 936