BP914995
Clone id YMU001_000065_C07
Library
Length 373
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000065_C07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAGATTTCAACTCCACATGCTGGAGTTAGTCTACAAGATTCCTCCATACTTTTACGAGT
ATGAGGATGAGAAAAGGAATATTTTCCAAGTGGTTAAAAAAGCACGATCCGGAGATGACC
TTCCTAACACAGTGTTGGTTAGACATCGAATTGACCACACGAAGGACAAAACGATTTATT
ACGATGCAATGGGAAATGATTATGAGATGGTATCCCATTCTTATCAAGTTTCCATAAAAT
CTAGGAAGGGGGGAGCACCCTTTGACACTACCTATAGCGAGAAACCTCCGCAAGTTTCAC
ATGTCTTTGTGCATGAAAAGACACTATCTGGTAGAGCCAATCTTGAAACCATGCATCTTC
CAAAAGAATCTCC
■■Homology search results ■■ -
sp_hit_id Q8BPP0
Definition sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus
Align length 75
Score (bit) 38.9
E-value 0.008
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914995|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_C07.
(373 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN... 39 0.008
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN... 37 0.031
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN... 37 0.031
sp|Q8E0C9|PEPB_STRA5 Group B oligopeptidase pepB OS=Streptococcu... 32 0.75
sp|Q53778|PEPB_STRA3 Group B oligopeptidase pepB OS=Streptococcu... 32 0.75
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 O... 32 0.98
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=... 31 1.7
sp|Q757F3|ATP10_ASHGO Mitochondrial ATPase complex subunit ATP10... 31 2.2
sp|O14341|RM35_SCHPO 60S ribosomal protein L35, mitochondrial OS... 31 2.2
sp|Q3YYF4|NORV_SHISS Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|P59405|NORV_SHIFL Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|Q0T1D5|NORV_SHIF8 Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|Q31X74|NORV_SHIBS Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|Q46877|NORV_ECOLI Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|B1IUW9|NORV_ECOLC Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|P59404|NORV_ECOL6 Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|A8A3I7|NORV_ECOHS Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|B1XCN7|NORV_ECODH Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|A7ZQD9|NORV_ECO24 Anaerobic nitric oxide reductase flavorubre... 31 2.2
sp|Q32CL8|NORV_SHIDS Anaerobic nitric oxide reductase flavorubre... 30 2.9
sp|B1LQ28|NORV_ECOSM Anaerobic nitric oxide reductase flavorubre... 30 2.9
sp|Q1JPG1|RS10B_BOVIN Radial spoke head 10 homolog B OS=Bos taur... 30 3.7
sp|A8GG94|NORV_SERP5 Anaerobic nitric oxide reductase flavorubre... 30 3.7
sp|Q8ZMJ7|NORV_SALTY Anaerobic nitric oxide reductase flavorubre... 30 3.7
sp|Q8Z4C5|NORV_SALTI Anaerobic nitric oxide reductase flavorubre... 30 3.7
sp|A9N0D9|NORV_SALPB Anaerobic nitric oxide reductase flavorubre... 30 3.7
sp|Q5PF19|NORV_SALPA Anaerobic nitric oxide reductase flavorubre... 30 3.7
sp|Q57KT3|NORV_SALCH Anaerobic nitric oxide reductase flavorubre... 30 3.7
sp|A8ANR7|NORV_CITK8 Anaerobic nitric oxide reductase flavorubre... 30 3.7
sp|P28137|WNT6_PLEJO Protein Wnt-6 (Fragment) OS=Plethodon jorda... 30 4.9

>sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus
GN=Znf436 PE=2 SV=1
Length = 452

Score = 38.9 bits (89), Expect = 0.008
Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
Frame = +3

Query: 126 NTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRKGGAPFDTTYSEKP-PQVSH 302
N+ LVRHR HT +K + + G ++ +SH Q ++ G P++ T K + SH
Sbjct: 300 NSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQ-RTHTGEKPYECTACGKSFSRSSH 358

Query: 303 VFVHEKTLSGRANLE 347
+ H+K +G E
Sbjct: 359 LITHQKIHTGEKPYE 373


>sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii
GN=ZNF436 PE=2 SV=1
Length = 470

Score = 37.0 bits (84), Expect = 0.031
Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
Frame = +3

Query: 126 NTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRKGGAPFDTTYSEKP-PQVSH 302
N+ LVRHR HT +K + + G ++ +SH Q ++ G P++ K + SH
Sbjct: 318 NSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQ-RTHTGEKPYECNACGKSFSRSSH 376

Query: 303 VFVHEKTLSGRANLE 347
+ H+K +G E
Sbjct: 377 LITHQKIHTGEKPYE 391


>sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens
GN=ZNF436 PE=2 SV=2
Length = 470

Score = 37.0 bits (84), Expect = 0.031
Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
Frame = +3

Query: 126 NTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRKGGAPFDTTYSEKP-PQVSH 302
N+ LVRHR HT +K + + G ++ +SH Q ++ G P++ K + SH
Sbjct: 318 NSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQ-RTHTGEKPYECNACGKSFSRSSH 376

Query: 303 VFVHEKTLSGRANLE 347
+ H+K +G E
Sbjct: 377 LITHQKIHTGEKPYE 391


>sp|Q8E0C9|PEPB_STRA5 Group B oligopeptidase pepB OS=Streptococcus
agalactiae serotype V GN=pepB PE=3 SV=1
Length = 601

Score = 32.3 bits (72), Expect = 0.75
Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 7/110 (6%)
Frame = +3

Query: 54 YEYEDEKRNIFQVVKKARSGDDLPNTVLVRHRIDHTKDKTIY---YDAMGNDYEMVSHSY 224
+E D +F VVK A+ G+++ T + + D+T+ Y AM + YE H+Y
Sbjct: 171 FEILDNADMVFPVVKNAK-GEEVELTHGNFISLMESSDRTVRKEAYQAMYSTYEQFQHTY 229

Query: 225 ----QVSIKSRKGGAPFDTTYSEKPPQVSHVFVHEKTLSGRANLETMHLP 362
Q ++KS+ A S + +S F+ E+ HLP
Sbjct: 230 AKTLQTNVKSQNFKARVHHYQSARQSALSANFIPEEVYETLIKTVNHHLP 279


>sp|Q53778|PEPB_STRA3 Group B oligopeptidase pepB OS=Streptococcus
agalactiae serotype III GN=pepB PE=3 SV=2
Length = 601

Score = 32.3 bits (72), Expect = 0.75
Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 7/110 (6%)
Frame = +3

Query: 54 YEYEDEKRNIFQVVKKARSGDDLPNTVLVRHRIDHTKDKTIY---YDAMGNDYEMVSHSY 224
+E D +F VVK A+ G+++ T + + D+T+ Y AM + YE H+Y
Sbjct: 171 FEILDNADMVFPVVKNAK-GEEVELTHGNFISLMESSDRTVRKEAYQAMYSTYEQFQHTY 229

Query: 225 ----QVSIKSRKGGAPFDTTYSEKPPQVSHVFVHEKTLSGRANLETMHLP 362
Q ++KS+ A S + +S F+ E+ HLP
Sbjct: 230 AKTLQTNVKSQNFKARVHHYQSARQSALSANFIPEEVYETLIKTVNHHLP 279


>sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08
OS=Schizosaccharomyces pombe GN=SPAC24C9.08 PE=2 SV=1
Length = 596

Score = 32.0 bits (71), Expect = 0.98
Identities = 24/87 (27%), Positives = 33/87 (37%), Gaps = 2/87 (2%)
Frame = +3

Query: 54 YEYEDEKRNIFQVVKKARSGDDLPN--TVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQ 227
Y Y E V+ + LP T+ V HR+D +K YD G E H Y
Sbjct: 405 YRYFFETSIAVDVINGGVKVNALPEETTLAVNHRVDASKGLKQVYDRYGGLLEEFGHEYH 464

Query: 228 VSIKSRKGGAPFDTTYSEKPPQVSHVF 308
V++ G T E + H+F
Sbjct: 465 VNVTLFNG-----ETVVEYEDAIGHIF 486


>sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens
GN=ZNF25 PE=2 SV=2
Length = 456

Score = 31.2 bits (69), Expect = 1.7
Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
Frame = +3

Query: 126 NTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRKGGAPFDTTYSEKP-PQVSH 302
N L+RH+ HT+DKT + +S S +++ G P++ EK Q H
Sbjct: 158 NEDLIRHQKIHTRDKTYECKECKKIFYHLS-SLSRHLRTHAGEKPYECNQCEKSFYQKPH 216

Query: 303 VFVHEKTLSGRANLE 347
+ H+KT +G E
Sbjct: 217 LTEHQKTHTGEKPFE 231


>sp|Q757F3|ATP10_ASHGO Mitochondrial ATPase complex subunit ATP10
OS=Ashbya gossypii GN=ATP10 PE=3 SV=1
Length = 272

Score = 30.8 bits (68), Expect = 2.2
Identities = 14/42 (33%), Positives = 23/42 (54%)
Frame = -2

Query: 372 EILLEDAWFQDWLYQIVSFHAQRHVKLAEVSRYR*CQRVLPP 247
EI L ++W +DWL ++++ + V A RY C+R P
Sbjct: 175 EISLTESWIKDWLVRLMAGRLRSLVPAARHERYFICRRAQLP 216


>sp|O14341|RM35_SCHPO 60S ribosomal protein L35, mitochondrial
OS=Schizosaccharomyces pombe GN=SPBC2F12.10 PE=2 SV=1
Length = 370

Score = 30.8 bits (68), Expect = 2.2
Identities = 15/46 (32%), Positives = 26/46 (56%)
Frame = +3

Query: 42 PPYFYEYEDEKRNIFQVVKKARSGDDLPNTVLVRHRIDHTKDKTIY 179
PP + ED+ R + V+++ S +P+ LVR R D ++ +IY
Sbjct: 284 PPIVHRGEDKHRILTLVLRQKSSSISIPSNALVRERFDLSEFCSIY 329


>sp|Q3YYF4|NORV_SHISS Anaerobic nitric oxide reductase
flavorubredoxin OS=Shigella sonnei (strain Ss046)
GN=norV PE=3 SV=1
Length = 479

Score = 30.8 bits (68), Expect = 2.2
Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 4/75 (5%)
Frame = +3

Query: 153 DHTKDK-TIYYDAMGNDYEMVSHSYQVSIKS---RKGGAPFDTTYSEKPPQVSHVFVHEK 320
D+ +D+ TI+YD M N+ M++ + I R F+ S+K +++VF +
Sbjct: 248 DYQEDRITIFYDTMSNNTRMMADAIAQGIAETDPRVAVKIFNVARSDKNEILTNVFRSKG 307

Query: 321 TLSGRANLETMHLPK 365
L G + + + +PK
Sbjct: 308 VLVGTSTMNNVMMPK 322


tr_hit_id Q923E2
Definition tr|Q923E2|Q923E2_MOUSE Zfp46 protein OS=Mus musculus
Align length 75
Score (bit) 38.9
E-value 0.13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914995|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_C07.
(373 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q923E2|Q923E2_MOUSE Zfp46 protein OS=Mus musculus GN=Zfp46 PE... 39 0.13
tr|Q562F8|Q562F8_MOUSE Zfp46 protein (Fragment) OS=Mus musculus ... 39 0.13
tr|A2AW50|A2AW50_MOUSE Zinc finger protein 46 OS=Mus musculus GN... 39 0.13
tr|Q1Q443|Q1Q443_9BACT Putative uncharacterized protein OS=Candi... 37 0.49
tr|A5EY41|A5EY41_DICNV Putative uncharacterized protein OS=Diche... 35 2.4
tr|A5BQ51|A5BQ51_VITVI Putative uncharacterized protein OS=Vitis... 35 2.4
tr|Q2C059|Q2C059_9GAMM Hypothetical cell cycle protein MesJ OS=P... 34 3.2
tr|Q1ZLG1|Q1ZLG1_9VIBR Hypothetical cell cycle protein MesJ OS=V... 34 3.2
tr|A3VG56|A3VG56_9RHOB Phenylacetate-CoA ligase OS=Rhodobacteral... 34 3.2
tr|A7QYQ4|A7QYQ4_VITVI Chromosome chr5 scaffold_253, whole genom... 34 4.1
tr|Q5ARK4|Q5ARK4_EMENI Predicted protein OS=Emericella nidulans ... 34 4.1
tr|A2ARR6|A2ARR6_MOUSE Novel KRAB box and zinc finger, C2H2 type... 33 5.4
tr|A5AWY0|A5AWY0_VITVI Putative uncharacterized protein OS=Vitis... 33 5.4
tr|A5AFD8|A5AFD8_VITVI Putative uncharacterized protein OS=Vitis... 33 5.4
tr|B4N891|B4N891_DROWI GK11080 OS=Drosophila willistoni GN=GK110... 33 5.4
tr|Q5V0S1|Q5V0S1_HALMA NADH dehydrogenase I chain C D OS=Haloarc... 33 5.4
tr|B5RDR3|B5RDR3_SALG2 Putative uncharacterized protein OS=Salmo... 33 7.0
tr|B5QW28|B5QW28_SALEP Putative uncharacterized protein OS=Salmo... 33 7.0
tr|Q3K1Q2|Q3K1Q2_STRA1 Group B oligopeptidase PepB OS=Streptococ... 33 7.1
tr|B5F422|B5F422_SALA4 CRISPR-associated protein Cas5 OS=Salmone... 33 9.2
tr|B1LQ80|B1LQ80_ECOSM CRISPR-associated protein Cas5 OS=Escheri... 33 9.2
tr|B4A247|B4A247_SALNE Crispr-associated protein Cas5 OS=Salmone... 33 9.2
tr|Q6DJB6|Q6DJB6_XENTR Amyloid beta (A4) protein OS=Xenopus trop... 33 9.2
tr|O52936|O52936_9CYAN Putative uncharacterized protein (Fragmen... 33 9.2
tr|B6HQ99|B6HQ99_PENCH Pc22g11450 protein OS=Penicillium chrysog... 33 9.2

>tr|Q923E2|Q923E2_MOUSE Zfp46 protein OS=Mus musculus GN=Zfp46 PE=2
SV=1
Length = 393

Score = 38.9 bits (89), Expect = 0.13
Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
Frame = +3

Query: 126 NTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRKGGAPFDTTYSEKP-PQVSH 302
N+ LVRHR HT +K + + G ++ +SH Q ++ G P++ T K + SH
Sbjct: 241 NSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQ-RTHTGEKPYECTACGKSFSRSSH 299

Query: 303 VFVHEKTLSGRANLE 347
+ H+K +G E
Sbjct: 300 LITHQKIHTGEKPYE 314


>tr|Q562F8|Q562F8_MOUSE Zfp46 protein (Fragment) OS=Mus musculus
GN=Zfp46 PE=2 SV=1
Length = 405

Score = 38.9 bits (89), Expect = 0.13
Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
Frame = +3

Query: 126 NTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRKGGAPFDTTYSEKP-PQVSH 302
N+ LVRHR HT +K + + G ++ +SH Q ++ G P++ T K + SH
Sbjct: 253 NSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQ-RTHTGEKPYECTACGKSFSRSSH 311

Query: 303 VFVHEKTLSGRANLE 347
+ H+K +G E
Sbjct: 312 LITHQKIHTGEKPYE 326


>tr|A2AW50|A2AW50_MOUSE Zinc finger protein 46 OS=Mus musculus
GN=Zfp46 PE=4 SV=1
Length = 452

Score = 38.9 bits (89), Expect = 0.13
Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
Frame = +3

Query: 126 NTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRKGGAPFDTTYSEKP-PQVSH 302
N+ LVRHR HT +K + + G ++ +SH Q ++ G P++ T K + SH
Sbjct: 300 NSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQ-RTHTGEKPYECTACGKSFSRSSH 358

Query: 303 VFVHEKTLSGRANLE 347
+ H+K +G E
Sbjct: 359 LITHQKIHTGEKPYE 373


>tr|Q1Q443|Q1Q443_9BACT Putative uncharacterized protein
OS=Candidatus Kuenenia stuttgartiensis GN=kuste4024 PE=4
SV=1
Length = 559

Score = 37.0 bits (84), Expect = 0.49
Identities = 17/41 (41%), Positives = 25/41 (60%)
Frame = -3

Query: 185 IVINRFVLRVVNSMSNQHCVRKVISGSCFFNHLENIPFLIL 63
IVIN F++++ N+ S C+ ++ CF NHL PF IL
Sbjct: 44 IVINTFLIKIQNTASQMRCLLRLF---CFINHLSCNPFFIL 81


>tr|A5EY41|A5EY41_DICNV Putative uncharacterized protein
OS=Dichelobacter nodosus (strain VCS1703A) GN=DNO_0944
PE=4 SV=1
Length = 244

Score = 34.7 bits (78), Expect = 2.4
Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
Frame = +3

Query: 72 KRNIFQVVKKARSGDDLPNTVLV---RHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIK 239
+RN F+ + + + D P+ R+ I KD+ +Y +GN+Y + H YQ+S K
Sbjct: 48 QRNRFEHLPEFKPSDKAPSVTYNARGRYAITDLKDRAVYKYPLGNEYVLEGHIYQLSDK 106


>tr|A5BQ51|A5BQ51_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034569 PE=4 SV=1
Length = 884

Score = 34.7 bits (78), Expect = 2.4
Identities = 23/82 (28%), Positives = 36/82 (43%)
Frame = +3

Query: 69 EKRNIFQVVKKARSGDDLPNTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRK 248
++ QV K RS + +T LVR +DH + +D + DY +S S + +
Sbjct: 615 QQATFVQVYAKTRSELSI-STGLVRRLVDHLDKEDFSFDHIHGDYNRISTSLRPHYQDVV 673

Query: 249 GGAPFDTTYSEKPPQVSHVFVH 314
FDT KP + F+H
Sbjct: 674 SFISFDTQEGNKPGEDVGKFLH 695


>tr|Q2C059|Q2C059_9GAMM Hypothetical cell cycle protein MesJ
OS=Photobacterium sp. SKA34 GN=SKA34_21274 PE=4 SV=1
Length = 438

Score = 34.3 bits (77), Expect = 3.2
Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 32/101 (31%)
Frame = +1

Query: 58 SMRMRKGIFSKWLKKHDPEMTFLTQ-------------------CWLDIELTTRRTKRFI 180
S R+ + +WLKK M L Q CW ++E+ + K ++
Sbjct: 259 SQRVGMALIRQWLKKQSVLMPSLAQLEQIWFNVVQAKEDANPKLCWANVEVRRYQKKLYL 318

Query: 181 TMQWEMIMRWY-------PILIKFP*NLG------RGEHPL 264
+QW+ I +W P L+ P NLG G++PL
Sbjct: 319 LLQWDDISQWQDNIDLDSPCLL--PQNLGTLVLNQEGDYPL 357


>tr|Q1ZLG1|Q1ZLG1_9VIBR Hypothetical cell cycle protein MesJ
OS=Vibrio angustum S14 GN=VAS14_21041 PE=4 SV=1
Length = 438

Score = 34.3 bits (77), Expect = 3.2
Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 32/101 (31%)
Frame = +1

Query: 58 SMRMRKGIFSKWLKKHDPEMTFLTQ-------------------CWLDIELTTRRTKRFI 180
S R+ + +WLKK M L Q CW ++E+ + K ++
Sbjct: 259 SQRVGMALIRQWLKKQSVLMPSLAQLEQIWFNVVQAKEDANPKLCWANVEVRRYQKKLYL 318

Query: 181 TMQWEMIMRWY-------PILIKFP*NLG------RGEHPL 264
+QW+ I +W P L+ P NLG G++PL
Sbjct: 319 LLQWDDISQWQNNIDLDSPCLL--PQNLGTLVLNQEGDYPL 357


>tr|A3VG56|A3VG56_9RHOB Phenylacetate-CoA ligase OS=Rhodobacterales
bacterium HTCC2654 GN=RB2654_06969 PE=4 SV=1
Length = 471

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/38 (36%), Positives = 21/38 (55%)
Frame = -1

Query: 319 FSCTKTCETCGGFSL*VVSKGAPPFLDFMET**EWDTI 206
+ CT+ CGG+S +G PF+ FME W+T+
Sbjct: 277 YGCTEASPHCGGYSCPEYQEGDEPFIHFMEDIQLWETV 314


>tr|A7QYQ4|A7QYQ4_VITVI Chromosome chr5 scaffold_253, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00010286001
PE=4 SV=1
Length = 736

Score = 33.9 bits (76), Expect = 4.1
Identities = 22/83 (26%), Positives = 37/83 (44%)
Frame = +3

Query: 69 EKRNIFQVVKKARSGDDLPNTVLVRHRIDHTKDKTIYYDAMGNDYEMVSHSYQVSIKSRK 248
++ QV K RS + +T LVR +DH + +D + DY +S S + +
Sbjct: 333 QQATFVQVYAKTRSELSI-STGLVRRLVDHLDKEDFSFDHIHGDYSRISTSLRPHYQGVV 391

Query: 249 GGAPFDTTYSEKPPQVSHVFVHE 317
FD+ KP + F+H+
Sbjct: 392 SFISFDSQEGNKPGEDIGKFLHQ 414