BP915000
Clone id YMU001_000065_D01
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000065_D01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGAATGATGAACTGCAAATTGTATCTGAAGGAACTTCATCGGAACTAAGAGTGAAACTGT
AACTGATCTTCAAATGTCTGGAACAAATCCTGAGGGAGTATCACCCCAATCTCAAAGTGA
ATTGGGAACAAACATCCAGTAGAAAGGAACACACATCAATATGGAGATTGCAACTAACAC
GGCAAGATCAAAAGAAGATCCTGCTACCAAGCTCTGCAAGAGAGGAACAAGGTGCTGTAG
AAAGCCACCAAATAGGCTGTCAATCCTGCTCGTTGCACATGGAACCACAAGAATTGTAAG
GAAGTAATCCGCGGAAACTGACTCCCAAGCTGGTGCCACATCGCCCTCTGAAGGGAGAAT
ACTCGAACCATTGATAAGCGTAATAACTCTCCAATAGTCTCTGCGTGTGTAGCTGAATCA
CCAAGGGAGGTGAATCCAAATGAAAATATACTTGTGGAACACACATCAATATGGAGACTG
CAACTAACACGGCAAGATAACCAGAAGATCCTGCTACCAAGCTCTACAACAGAGGAACAA
GGTGCTGTAG
■■Homology search results ■■ -
sp_hit_id P25173
Definition sp|P25173|VP4_ROTB4 Outer capsid protein VP4 OS=Rotavirus A (strain Cow/United States/B641/198? G6-P7[5]-Ix-Rx-Cx-Mx-A3-Nx-Tx-Ex-Hx)
Align length 39
Score (bit) 34.3
E-value 0.41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915000|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_D01.
(550 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P25173|VP4_ROTB4 Outer capsid protein VP4 OS=Rotavirus A (str... 34 0.41
sp|P12474|VP4_ROTBU Outer capsid protein VP4 OS=Rotavirus A (str... 33 1.2
sp|Q9H2D6|TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sa... 31 3.5
sp|Q8H0W9|CAP17_ARATH Putative clathrin assembly protein At5g104... 31 3.5
sp|P57648|Y588_BUCAI Uncharacterized transporter BU588 OS=Buchne... 31 4.5
sp|O13818|YEE2_SCHPO Uncharaterized PH domain-containing protein... 31 4.6
sp|Q5HBQ7|MUTS_EHRRW DNA mismatch repair protein mutS OS=Ehrlich... 30 6.0
sp|A9HWW6|SYL_BORPD Leucyl-tRNA synthetase OS=Bordetella petrii ... 30 7.7
sp|Q15VI3|RLMF_PSEA6 Ribosomal RNA large subunit methyltransfera... 30 7.7
sp|Q5R5R2|HEAT6_PONAB HEAT repeat-containing protein 6 OS=Pongo ... 30 7.8
sp|Q6AI08|HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo s... 30 7.8

>sp|P25173|VP4_ROTB4 Outer capsid protein VP4 OS=Rotavirus A (strain
Cow/United States/B641/198?
G6-P7[5]-Ix-Rx-Cx-Mx-A3-Nx-Tx-Ex-Hx) GN=S4 PE=3 SV=2
Length = 776

Score = 34.3 bits (77), Expect = 0.41
Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
Frame = +1

Query: 379 RNNSPIVSACVAESPREVNPNENILVEHTSIWR-LQLTR 492
RN P+ + + PR+V PNE+I+V TS+W+ LQ R
Sbjct: 231 RNVVPLAISSRSIKPRKVQPNEDIVVSKTSLWKELQYNR 269


>sp|P12474|VP4_ROTBU Outer capsid protein VP4 OS=Rotavirus A (strain
Cow/United Kingdom/UK/1975
G6-P7[5]-I2-R2-C2-M2-A3-N2-T7-E2-H3) GN=S4 PE=3 SV=1
Length = 776

Score = 32.7 bits (73), Expect = 1.2
Identities = 14/33 (42%), Positives = 21/33 (63%)
Frame = +1

Query: 379 RNNSPIVSACVAESPREVNPNENILVEHTSIWR 477
RN P+ + + PREV NE+I+V TS+W+
Sbjct: 231 RNVVPVAISSRSIKPREVQANEDIVVSKTSLWK 263


>sp|Q9H2D6|TARA_HUMAN TRIO and F-actin-binding protein OS=Homo
sapiens GN=TRIOBP PE=1 SV=3
Length = 2365

Score = 31.2 bits (69), Expect = 3.5
Identities = 20/58 (34%), Positives = 28/58 (48%)
Frame = +1

Query: 364 RTIDKRNNSPIVSACVAESPREVNPNENILVEHTSIWRLQLTRQDNQKILLPSSTTEE 537
RTI + N P S ++PR +PN I E+ R TRQDN + P+ T +
Sbjct: 737 RTIQRDN--PRTSCAQRDNPRASSPNRTIQQENL---RTSCTRQDNPRTSSPNRATRD 789


>sp|Q8H0W9|CAP17_ARATH Putative clathrin assembly protein At5g10410
OS=Arabidopsis thaliana GN=At5g10410 PE=2 SV=2
Length = 338

Score = 31.2 bits (69), Expect = 3.5
Identities = 18/54 (33%), Positives = 29/54 (53%)
Frame = +1

Query: 331 WCHIAL*RENTRTIDKRNNSPIVSACVAESPREVNPNENILVEHTSIWRLQLTR 492
+ H+AL + TRT +K NS VSA ++ S P ++WRL++T+
Sbjct: 34 YIHLALLKSTTRTPNKPPNSDYVSAVISYSNSRYAP----AAFSAALWRLRVTK 83


>sp|P57648|Y588_BUCAI Uncharacterized transporter BU588 OS=Buchnera
aphidicola subsp. Acyrthosiphon pisum GN=BU588 PE=3 SV=1
Length = 410

Score = 30.8 bits (68), Expect = 4.5
Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 1/87 (1%)
Frame = -3

Query: 476 LHIDVCSTSIFSFGFTSLGDSATHAETIGELLRLSMVRVFSLQRAMWHQLGSQFPRITSL 297
L I + IFS GF +T + +G ++ ++ SL ++ S F
Sbjct: 315 LFIIILGLIIFSGGF--FASHSTASSWVGSYSNIAKIQATSLYLFFYYLGSSVFGTFGG- 371

Query: 296 QFLWFHVQRAGLTAYLVA-FYSTLFLS 219
F WFH+Q G++ +++ + +FLS
Sbjct: 372 -FFWFHMQWLGISVFIITMLFFGVFLS 397


>sp|O13818|YEE2_SCHPO Uncharaterized PH domain-containing protein
C19A8.02 OS=Schizosaccharomyces pombe GN=SPAC19A8.02
PE=2 SV=1
Length = 1213

Score = 30.8 bits (68), Expect = 4.6
Identities = 11/27 (40%), Positives = 17/27 (62%)
Frame = -2

Query: 459 FHKYIFIWIHLPW*FSYTRRDYWRVIT 379
+H YI W+H W Y RDY++++T
Sbjct: 864 YHLYIMTWLHHSWTLPY--RDYFKIVT 888


>sp|Q5HBQ7|MUTS_EHRRW DNA mismatch repair protein mutS OS=Ehrlichia
ruminantium (strain Welgevonden) GN=mutS PE=3 SV=1
Length = 804

Score = 30.4 bits (67), Expect = 6.0
Identities = 14/31 (45%), Positives = 19/31 (61%)
Frame = -1

Query: 175 SCNLHIDVCSFLLDVCSQFTLRLG*YSLRIC 83
+C L +C F +D+ S+F LRLG Y IC
Sbjct: 378 TCELVELLCKFNIDIISEFCLRLGRYEDLIC 408


>sp|A9HWW6|SYL_BORPD Leucyl-tRNA synthetase OS=Bordetella petrii
(strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=leuS
PE=3 SV=1
Length = 885

Score = 30.0 bits (66), Expect = 7.7
Identities = 19/53 (35%), Positives = 24/53 (45%)
Frame = -3

Query: 413 ATHAETIGELLRLSMVRVFSLQRAMWHQLGSQFPRITSLQFLWFHVQRAGLTA 255
A AET+G LLR+ V + +W +LG L W HV A L A
Sbjct: 771 AARAETLGVLLRVLYPVVPHVTWLLWRELGYTHSLGDLLDAPWPHVDEAALVA 823


>sp|Q15VI3|RLMF_PSEA6 Ribosomal RNA large subunit methyltransferase
F OS=Pseudoalteromonas atlantica (strain T6c / BAA-1087)
GN=rlmF PE=3 SV=1
Length = 330

Score = 30.0 bits (66), Expect = 7.7
Identities = 14/31 (45%), Positives = 18/31 (58%)
Frame = -3

Query: 527 VELGSRIFWLSCRVSCSLHIDVCSTSIFSFG 435
VE S++ W +C VS SLH+ TS FG
Sbjct: 275 VEYQSQVGWFTCLVSKSLHLKAIETSARYFG 305


>sp|Q5R5R2|HEAT6_PONAB HEAT repeat-containing protein 6 OS=Pongo
abelii GN=HEATR6 PE=2 SV=1
Length = 1181

Score = 30.0 bits (66), Expect = 7.8
Identities = 21/76 (27%), Positives = 36/76 (47%)
Frame = -2

Query: 357 LPSEGDVAPAWESVSADYFLTILVVPCATSRIDSLFGGFLQHLVPLLQSLVAGSSFDLAV 178
+P + + +++V FLTIL P ++ D F LQ+ + +QSL+ G L
Sbjct: 196 VPGQPYLEEPYQNVCFQAFLTILQSPKSSDMDDITFCMLLQNALKGIQSLLNGGRMKLTQ 255

Query: 177 LVAISILMCVPFYWMF 130
+ L+ V +MF
Sbjct: 256 TDELGALLAVLKKFMF 271


tr_hit_id A2FR74
Definition tr|A2FR74|A2FR74_TRIVA Putative uncharacterized protein OS=Trichomonas vaginalis G3
Align length 55
Score (bit) 36.6
E-value 0.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915000|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_D01.
(550 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2FR74|A2FR74_TRIVA Putative uncharacterized protein OS=Trich... 37 0.90
tr|Q4QBQ4|Q4QBQ4_LEIMA Putative uncharacterized protein OS=Leish... 34 4.5
tr|Q6A852|Q6A852_PROAC Putative DNA helicase II homolog OS=Propi... 34 5.9
tr|B1T0P7|B1T0P7_9BURK Sodium/glutamate symporter OS=Burkholderi... 34 5.9
tr|Q23UC7|Q23UC7_TETTH Putative uncharacterized protein OS=Tetra... 33 7.5
tr|Q4SK11|Q4SK11_TETNG Chromosome 10 SCAF14571, whole genome sho... 33 9.8
tr|Q30KM5|Q30KM5_MOUSE Beta-defensin 52 (Fragment) OS=Mus muscul... 33 10.0
tr|A1A4N1|A1A4N1_BOVIN Solute carrier family 29 (Nucleoside tran... 33 10.0
tr|B0E9Y2|B0E9Y2_ENTDI Putative uncharacterized protein OS=Entam... 33 10.0

>tr|A2FR74|A2FR74_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_496240 PE=4 SV=1
Length = 1167

Score = 36.6 bits (83), Expect = 0.90
Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 2/55 (3%)
Frame = +1

Query: 373 DKRNNSPIVSACVAESPREVNPNE--NILVEHTSIWRLQLTRQDNQKILLPSSTT 531
+ +NNS I A + +S ++ PNE N++ ++ I +L T D +K ++P S+T
Sbjct: 597 EMKNNSNIFKAFILDSALQIAPNEWWNLIKKNPEILKLNFTENDFKKSMIPISST 651


>tr|Q4QBQ4|Q4QBQ4_LEIMA Putative uncharacterized protein
OS=Leishmania major GN=LmjF22.0930 PE=4 SV=1
Length = 718

Score = 34.3 bits (77), Expect = 4.5
Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 6/51 (11%)
Frame = -2

Query: 255 LFGGFLQHLVPLLQSLVAGSSFDLAVLVAIS------ILMCVPFYWMFVPN 121
LF G L+ + PLL+S + GSS L ++V + I+ PF+++ VPN
Sbjct: 59 LFAGLLRVVRPLLESWIMGSSVTLGMVVGLPYIQRNIIVQLPPFFFVEVPN 109


>tr|Q6A852|Q6A852_PROAC Putative DNA helicase II homolog
OS=Propionibacterium acnes GN=PPA1314 PE=4 SV=1
Length = 706

Score = 33.9 bits (76), Expect = 5.9
Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 1/79 (1%)
Frame = -2

Query: 402 RDYWRVITLINGSSILPS-EGDVAPAWESVSADYFLTILVVPCATSRIDSLFGGFLQHLV 226
R + R++ S+I P EGDV WES+ A + LT+ VV T ++ L F +
Sbjct: 434 RAFDRILAAQGWSAIAPDGEGDVRQRWESLQALHDLTVSVVDDGTRTLEELAAVFSRRAA 493

Query: 225 PLLQSLVAGSSFDLAVLVA 169
Q G LA L A
Sbjct: 494 --TQEAPVGDGVTLATLHA 510


>tr|B1T0P7|B1T0P7_9BURK Sodium/glutamate symporter OS=Burkholderia
ambifaria MEX-5 GN=BamMEX5DRAFT_1363 PE=4 SV=1
Length = 411

Score = 33.9 bits (76), Expect = 5.9
Identities = 19/68 (27%), Positives = 37/68 (54%)
Frame = -2

Query: 222 LLQSLVAGSSFDLAVLVAISILMCVPFYWMFVPNSL*DWGDTPSGFVPDI*RSVTVSLLV 43
+++SL+ G++F+L V CV F + + N L +G PSG + +V++SL +
Sbjct: 245 VIESLIRGTAFELPTFV------CVLFVGVVLSNGLAAFGHRPSGHAVSLLGNVSLSLFL 298

Query: 42 PMKFLQIQ 19
M + ++
Sbjct: 299 AMALMTLR 306


>tr|Q23UC7|Q23UC7_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00797990 PE=4
SV=1
Length = 834

Score = 33.5 bits (75), Expect = 7.5
Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
Frame = +3

Query: 132 TSSRKEHTSIWRLQLTRQDQKKILLPSSAREEQGAVESHQIG----CQSCSLHMEPQEL* 299
+ +R EH S + Q +Q+ K+ L S ++ + H I QS +H ++
Sbjct: 16 SQARTEHKSQGQHQFNKQNLKENLEQPSQSQQPQTLHQHHIQNQNQVQSQQIHQNQHQIL 75

Query: 300 GSNPRKLTPKLVPHRPLKGEYSN 368
G++ RKL PK VP ++ +N
Sbjct: 76 GASNRKLVPK-VPQETVQNLKAN 97


>tr|Q4SK11|Q4SK11_TETNG Chromosome 10 SCAF14571, whole genome
shotgun sequence OS=Tetraodon nigroviridis
GN=GSTENG00016951001 PE=4 SV=1
Length = 651

Score = 33.1 bits (74), Expect = 9.8
Identities = 23/75 (30%), Positives = 33/75 (44%)
Frame = +3

Query: 102 HPNLKVNWEQTSSRKEHTSIWRLQLTRQDQKKILLPSSAREEQGAVESHQIGCQSCSLHM 281
H L W+ K+ S+ LT + Q L+PS +REE V + C+ LH+
Sbjct: 228 HDRLLSVWQVREDGKDKNSVVSFALTDEPQHIDLIPSKSREE---VMRLAVVCKDGQLHL 284

Query: 282 EPQEL*GSNPRKLTP 326
L G + LTP
Sbjct: 285 FEHFLNGPCKKPLTP 299


>tr|Q30KM5|Q30KM5_MOUSE Beta-defensin 52 (Fragment) OS=Mus musculus
GN=Defb52 PE=2 SV=1
Length = 68

Score = 33.1 bits (74), Expect = 10.0
Identities = 19/53 (35%), Positives = 24/53 (45%)
Frame = +2

Query: 89 PEGVSPQSQSELGTNIQ*KGTHINMEIATNTARSKEDPATKLCKRGTRCCRKP 247
PEG + Q+E Q KGT IN I + P T +R T+C R P
Sbjct: 1 PEGCKQERQNEWKDLAQKKGTFINAFINNYEHHYCDSPTTVCLRRKTKCIRMP 53


>tr|A1A4N1|A1A4N1_BOVIN Solute carrier family 29 (Nucleoside
transporters), member 3 OS=Bos taurus GN=SLC29A3 PE=2
SV=1
Length = 474

Score = 33.1 bits (74), Expect = 10.0
Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 1/95 (1%)
Frame = -2

Query: 429 LPW*FSYTRRDYWRVITLINGSSILPSEGDVAPAWESVSADYFLTILVVPCATSRIDSLF 250
LPW F T ++YW + L N SS P+ G+ +S +YF + L V + L
Sbjct: 66 LPWNFFVTAQEYW-IFKLSNCSS--PAAGEEPK--DSDILNYFESYLAVASTVPSVLCLA 120

Query: 249 GGF-LQHLVPLLQSLVAGSSFDLAVLVAISILMCV 148
F L + VP+ ++A + LA+ + +++L+ V
Sbjct: 121 LNFLLVNRVPIRVRVLASLTVMLAIFIVMTVLVKV 155


>tr|B0E9Y2|B0E9Y2_ENTDI Putative uncharacterized protein
OS=Entamoeba dispar SAW760 GN=EDI_021970 PE=4 SV=1
Length = 507

Score = 33.1 bits (74), Expect = 10.0
Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 6/149 (4%)
Frame = -1

Query: 454 QVYFHLDSPPLVIQLHTQRLLESYYAYQWFEYSPFRGRCGTSL--GVSFRGLLPYNSCGS 281
Q+Y D+P L ++LH+Q+L+E Y Q+ + P + G YN
Sbjct: 90 QLYIRYDNPNL-LKLHSQQLIEKYCMNQYLKSIPMKSCLKNEFERKTKVPGYYIYNYGIV 148

Query: 280 MCNEQD*QPIWWLSTAPCS-SLAELGSRIF--F*SCRVSCNLHIDVCSFLLDV-CSQFTL 113
NE + I + + PC SL + I + + N+HI +FL D+ L
Sbjct: 149 GINESKFEDIVYTAHIPCMISLIDQQFPIISVTFTMLIPSNIHISNNTFLWDIFLDNLNL 208

Query: 112 RLG*YSLRICSRHLKISYSFTLSSDEVPS 26
+ L+ H K S+ L +D + S
Sbjct: 209 LFFEFQLKHLEEHGKNIESYKLLNDSLTS 237