BP915013
Clone id YMU001_000065_E03
Library
Length 521
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000065_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CACTCACATCTAGTATCCAATGTGAAGGTAATGTGTCGTCAAAAACCGACATAAGAAAGT
CAAGAGTAAACATGGAAGCAAAGTCGACATCTCCGTCACGCGTAGCCACATACGCTACAT
CTGTTCTCACATCATCCAAAGTGATAGCATCCCTCTTGTGCTGTCTCCTGTGCTGTCTCA
TCCGATGAAAACAACGCCTACGTACATGCCCTGTATGACCACAATGCCAACAGACAACAT
CTCTATGTCTGCAAGATCGTCCTTTGACTGTAGGCATCTCTCTAAACTCATTTGTGCCAA
AAGCATTGCACAATCTTTACCATAACTCTCTAGTTGTACATGCATCAAACCCAATGCGAT
AGACAGACTCACCAAGGTGTAACATGATCGTCGAACGTGCAAGCTCATCCAAGTCCTCCC
ACTCATCGTCAGTCATTGACTCTGGCCTAGCATCCATGCCTTGTAGTGGCAACACTTGGC
CCAACTGAGTCAATGCATCATGCATACCTGCATTCCAATGC
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 69
Score (bit) 49.7
E-value 8.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915013|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_E03.
(521 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 50 8e-06
sp|B0RAP7|SYR_CLAMS Arginyl-tRNA synthetase OS=Clavibacter michi... 32 1.4
sp|A0LII5|RPOC_SYNFM DNA-directed RNA polymerase subunit beta' O... 30 5.3
sp|Q6AG81|SYR_LEIXX Arginyl-tRNA synthetase OS=Leifsonia xyli su... 30 6.9
sp|Q5UXW4|SYH_HALMA Histidyl-tRNA synthetase OS=Haloarcula maris... 30 9.0
sp|P53536|PHSL_VICFA Alpha-1,4 glucan phosphorylase L isozyme, c... 30 9.0

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 49.7 bits (117), Expect = 8e-06
Identities = 27/69 (39%), Positives = 34/69 (49%)
Frame = -2

Query: 517 WNAGMHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDAC 338
W M D L Q G L +P++M ++W DLDE A S I LHL + V D
Sbjct: 20 WQRRMRDLLIQQGLHKVLDVDSKKPDTMKAEDWADLDERAASAIRLHLSDDVVNNIIDED 79

Query: 337 TTRELW*RL 311
T R +W RL
Sbjct: 80 TARGIWTRL 88


>sp|B0RAP7|SYR_CLAMS Arginyl-tRNA synthetase OS=Clavibacter
michiganensis subsp. sepedonicus (strain ATCC 33113 /
JCM 9667) GN=argS PE=3 SV=1
Length = 554

Score = 32.3 bits (72), Expect = 1.4
Identities = 17/62 (27%), Positives = 27/62 (43%)
Frame = -2

Query: 484 LGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDACTTRELW*RLCN 305
L ++L +G D E +D +D ARS + HLGE G+ E+ R+
Sbjct: 152 LARILQAEGADVTREYYFNDHGSQIDRFARSLLASHLGEETPEDGYGGAYIGEIAERVVE 211

Query: 304 AF 299
+
Sbjct: 212 GY 213


>sp|A0LII5|RPOC_SYNFM DNA-directed RNA polymerase subunit beta'
OS=Syntrophobacter fumaroxidans (strain DSM 10017 /
MPOB) GN=rpoC PE=3 SV=1
Length = 1351

Score = 30.4 bits (67), Expect = 5.3
Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
Frame = -2

Query: 505 MHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARS-TIMLHLGESVYRIGFDA 341
+++ L + G V ++ E T + W+ LDE+ R +ML+ +++R+G A
Sbjct: 381 IYNKLEEKGYVTTIKAAKKMVERETPEVWDTLDEVVREFPVMLNRAPTLHRLGIQA 436


>sp|Q6AG81|SYR_LEIXX Arginyl-tRNA synthetase OS=Leifsonia xyli
subsp. xyli GN=argS PE=3 SV=1
Length = 562

Score = 30.0 bits (66), Expect = 6.9
Identities = 14/46 (30%), Positives = 22/46 (47%)
Frame = -2

Query: 484 LGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGF 347
L ++L +G D E +D +D ARS + H GE+ G+
Sbjct: 156 LARILQAEGADVTREYYFNDHGSQIDRFARSLLAAHRGEATPEDGY 201


>sp|Q5UXW4|SYH_HALMA Histidyl-tRNA synthetase OS=Haloarcula
marismortui GN=hisS PE=3 SV=1
Length = 435

Score = 29.6 bits (65), Expect = 9.0
Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
Frame = -3

Query: 288 SLERCLQSKDDLADIEMLSVGIVVIQGM--YVGVVFIG*DSTGDSTRGM 148
+L+ L + +D E L+V + +G+ Y GVVF DSTG+ +R +
Sbjct: 243 NLQAVLDAAEDFGVREHLTVSLTTARGLDYYTGVVFECFDSTGEVSRSV 291


>sp|P53536|PHSL_VICFA Alpha-1,4 glucan phosphorylase L isozyme,
chloroplastic/amyloplastic OS=Vicia faba GN=PHO1 PE=2
SV=2
Length = 1003

Score = 29.6 bits (65), Expect = 9.0
Identities = 16/43 (37%), Positives = 24/43 (55%)
Frame = +3

Query: 12 SIQCEGNVSSKTDIRKSRVNMEAKSTSPSRVATYATSVLTSSK 140
S++C +K ++ V EAK TSPS A TS+++S K
Sbjct: 61 SVKCGSGNEAKQKVKDQEVQQEAK-TSPSSFAPDTTSIVSSIK 102


tr_hit_id Q9AU17
Definition tr|Q9AU17|Q9AU17_SOLCI Polyprotein-like OS=Solanum chilense
Align length 73
Score (bit) 49.7
E-value 9.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915013|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_E03.
(521 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9AU17|Q9AU17_SOLCI Polyprotein-like OS=Solanum chilense PE=4... 50 9e-05
tr|A5BAR0|A5BAR0_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|Q2QVJ2|Q2QVJ2_ORYSJ Retrotransposon protein, putative, Ty1-co... 41 0.031
tr|Q2QP15|Q2QP15_ORYSJ Retrotransposon protein, putative, Ty1-co... 41 0.041
tr|Q7XEC4|Q7XEC4_ORYSJ Retrotransposon protein, putative, Ty1-co... 39 0.15
tr|Q2R2H8|Q2R2H8_ORYSJ Retrotransposon protein, putative, Ty1-co... 39 0.15
tr|B8YLY5|B8YLY5_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 39 0.20
tr|B8YLY4|B8YLY4_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 39 0.20
tr|B8YLY3|B8YLY3_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 39 0.20
tr|A5C7D0|A5C7D0_VITVI Putative uncharacterized protein OS=Vitis... 38 0.34
tr|Q2AA73|Q2AA73_ASPOF Polyprotein-like, related OS=Asparagus of... 37 0.45
tr|A5B695|A5B695_VITVI Putative uncharacterized protein OS=Vitis... 37 0.45
tr|A5B9V6|A5B9V6_VITVI Putative uncharacterized protein OS=Vitis... 37 0.59
tr|A5ATZ7|A5ATZ7_VITVI Putative uncharacterized protein OS=Vitis... 37 0.77
tr|A7QTZ9|A7QTZ9_VITVI Chromosome undetermined scaffold_174, who... 35 1.7
tr|A5AT67|A5AT67_VITVI Putative uncharacterized protein OS=Vitis... 35 1.7
tr|A5AEN5|A5AEN5_VITVI Putative uncharacterized protein OS=Vitis... 35 1.7
tr|A5BDN3|A5BDN3_VITVI Putative uncharacterized protein OS=Vitis... 35 2.2
tr|B8YLY6|B8YLY6_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 35 2.9
tr|A5AQ94|A5AQ94_VITVI Putative uncharacterized protein OS=Vitis... 35 2.9
tr|A5AMN2|A5AMN2_VITVI Putative uncharacterized protein OS=Vitis... 35 2.9
tr|A5ATT1|A5ATT1_VITVI Putative uncharacterized protein OS=Vitis... 34 3.8
tr|A7PWI3|A7PWI3_VITVI Chromosome chr8 scaffold_34, whole genome... 34 5.0
tr|B4WP33|B4WP33_9SYNE Cytochrome C assembly protein OS=Synechoc... 33 6.5
tr|A5B4P6|A5B4P6_VITVI Putative uncharacterized protein OS=Vitis... 33 6.5
tr|A5APH6|A5APH6_VITVI Putative uncharacterized protein OS=Vitis... 33 6.5
tr|B4JHI7|B4JHI7_DROGR GH18624 OS=Drosophila grimshawi GN=GH1862... 33 6.5
tr|Q9FI33|Q9FI33_ARATH Gb|AAF63108.1 OS=Arabidopsis thaliana GN=... 33 8.5
tr|A5B0E4|A5B0E4_VITVI Putative uncharacterized protein OS=Vitis... 33 8.5

>tr|Q9AU17|Q9AU17_SOLCI Polyprotein-like OS=Solanum chilense PE=4
SV=1
Length = 1328

Score = 49.7 bits (117), Expect = 9e-05
Identities = 28/73 (38%), Positives = 37/73 (50%)
Frame = -2

Query: 517 WNAGMHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDAC 338
W M D L Q G L G +PESM ++WE+LDE A S I LHL + V D
Sbjct: 21 WQRRMKDLLIQQGLHKALGGKSKKPESMKLEDWEELDEKAASAIRLHLTDDVVNNIVDEE 80

Query: 337 TTRELW*RLCNAF 299
+ +W +L N +
Sbjct: 81 SACGIWTKLENLY 93


>tr|A5BAR0|A5BAR0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_025722 PE=4 SV=1
Length = 347

Score = 45.8 bits (107), Expect = 0.001
Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 7/110 (6%)
Frame = -2

Query: 517 WNAGMHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVY----RIG 350
W+ + D L Q G V L G +PE M D +W+DL+ +TI L L V +
Sbjct: 23 WHRRVKDLLVQQGMVKALYGK--QPEGMNDIDWKDLEAKVAATIRLCLANDVMYHMKKAN 80

Query: 349 FDACTTRELW*RLCNAFGTNEFREMPT---VKGRSCRHRDVVCWHCGHTG 209
++ L + G N+FR + + +S + +D+ C+ CG G
Sbjct: 81 DESSQGERLMVKSNQERGRNKFRSESSNNKSRSKSKKRKDIQCYKCGKKG 130


>tr|Q2QVJ2|Q2QVJ2_ORYSJ Retrotransposon protein, putative, Ty1-copia
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g12620 PE=4 SV=1
Length = 424

Score = 41.2 bits (95), Expect = 0.031
Identities = 23/73 (31%), Positives = 37/73 (50%)
Frame = -2

Query: 517 WNAGMHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDAC 338
W + D L Q G L+ + PE M +WE++ A +TI L L +SV D
Sbjct: 23 WQMRLKDLLAQQGISKALE--ETMPEKMDAGKWEEMKAQAAATIRLSLSDSVMYQVMDEK 80

Query: 337 TTRELW*RLCNAF 299
T++E+W +L + +
Sbjct: 81 TSKEIWVKLTSLY 93


>tr|Q2QP15|Q2QP15_ORYSJ Retrotransposon protein, putative, Ty1-copia
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g36020 PE=4 SV=1
Length = 425

Score = 40.8 bits (94), Expect = 0.041
Identities = 23/73 (31%), Positives = 36/73 (49%)
Frame = -2

Query: 517 WNAGMHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDAC 338
W + D L Q G L+ + PE M +WE++ A +TI L L +SV D
Sbjct: 23 WQMRLKDLLAQQGISKALE--ETMPEKMDAGKWEEMKAQAAATIRLSLSDSVMYPVMDEK 80

Query: 337 TTRELW*RLCNAF 299
T +E+W +L + +
Sbjct: 81 TPKEIWDKLASLY 93


>tr|Q7XEC4|Q7XEC4_ORYSJ Retrotransposon protein, putative, Ty1-copia
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os10g29210 PE=4 SV=2
Length = 415

Score = 38.9 bits (89), Expect = 0.15
Identities = 22/71 (30%), Positives = 35/71 (49%)
Frame = -2

Query: 517 WNAGMHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDAC 338
W + D L Q G LQ + PE + D+W ++ A +TI L L +SV D
Sbjct: 23 WQMRLKDLLAQQGISKALQ--ETMPEKIDADKWNEMKAQAAATIRLSLSDSVMYQVMDEK 80

Query: 337 TTRELW*RLCN 305
+ +E+W +L +
Sbjct: 81 SPKEIWDKLAS 91


>tr|Q2R2H8|Q2R2H8_ORYSJ Retrotransposon protein, putative, Ty1-copia
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os11g35770 PE=4 SV=2
Length = 375

Score = 38.9 bits (89), Expect = 0.15
Identities = 21/69 (30%), Positives = 36/69 (52%)
Frame = -2

Query: 505 MHDALTQLGQVLPLQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDACTTRE 326
+ D L Q G L+ + PE M DD+W+++ A +TI L L + V D + +E
Sbjct: 27 LKDLLAQQGISKALE--ETMPEKMDDDKWDEMKAQAAATIRLRLSDFVMYQVMDEKSPKE 84

Query: 325 LW*RLCNAF 299
+W +L + +
Sbjct: 85 IWDKLASLY 93


>tr|B8YLY5|B8YLY5_MEDTR Gag-Pol polyprotein OS=Medicago truncatula
PE=4 SV=1
Length = 1305

Score = 38.5 bits (88), Expect = 0.20
Identities = 18/70 (25%), Positives = 35/70 (50%)
Frame = -2

Query: 466 LQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDACTTRELW*RLCNAFGTNE 287
L +D RP +TD++W+++D+ A + + L + +SV + T +E+W L +
Sbjct: 32 LDAIDGRPADITDEKWKEMDDNAVANLHLAMADSVLSSIAEKKTAKEIWDTLIKLYEVKS 91

Query: 286 FREMPTVKGR 257
+K R
Sbjct: 92 LHNRIFLKRR 101


>tr|B8YLY4|B8YLY4_MEDTR Gag-Pol polyprotein OS=Medicago truncatula
PE=4 SV=1
Length = 1305

Score = 38.5 bits (88), Expect = 0.20
Identities = 18/70 (25%), Positives = 35/70 (50%)
Frame = -2

Query: 466 LQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDACTTRELW*RLCNAFGTNE 287
L +D RP +TD++W+++D+ A + + L + +SV + T +E+W L +
Sbjct: 32 LDAIDGRPADITDEKWKEMDDNAVANLHLAMADSVLSSIAEKKTAKEIWDTLIKLYEVKS 91

Query: 286 FREMPTVKGR 257
+K R
Sbjct: 92 LHNRIFLKRR 101


>tr|B8YLY3|B8YLY3_MEDTR Gag-Pol polyprotein OS=Medicago truncatula
PE=4 SV=1
Length = 1305

Score = 38.5 bits (88), Expect = 0.20
Identities = 18/70 (25%), Positives = 35/70 (50%)
Frame = -2

Query: 466 LQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDACTTRELW*RLCNAFGTNE 287
L +D RP +TD++W+++D+ A + + L + +SV + T +E+W L +
Sbjct: 32 LDAIDGRPADITDEKWKEMDDNAVANLHLAMADSVLSSIAEKKTAKEIWDTLIKLYEVKS 91

Query: 286 FREMPTVKGR 257
+K R
Sbjct: 92 LHNRIFLKRR 101


>tr|A5C7D0|A5C7D0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_044310 PE=4 SV=1
Length = 159

Score = 37.7 bits (86), Expect = 0.34
Identities = 22/59 (37%), Positives = 33/59 (55%)
Frame = -2

Query: 466 LQGMDARPESMTDDEWEDLDELARSTIMLHLGESVYRIGFDACTTRELW*RLCNAFGTN 290
L+G + P M+D+E +L E A S I+L LG V + TT +LW +L + + TN
Sbjct: 86 LKGRETLPTMMSDEEKYELMEKAYSVILLCLGNKVLCEDVEEGTTTKLWLKLESVYMTN 144