BP915014
Clone id YMU001_000065_E04
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000065_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACATATCCAACTCTTGTTGGTAATCGTTGATAGTTCTAACCCAACCGTCTTAGACGAAAA
ATCCAATCAAGACACAAATAACTGATGAAAGATACAACCACATGAAGCGCTTTTCTGATT
CCAGAAAACAATTGGGACAGGAGAGAATAGCTATTAGTTCTTGTTTGAGCTTTATTGGAT
TCGTGTCGTCATCGTCGGAAAAAATCTTTCGTGATCTCTGAACAATCACTTGCCAAGACG
CCTCCTCTTACTCTAATATTAGGGTTAAATGGATGTACAAGACCTCTCTTCTTGGCTGCC
CCCTTCATTTCACAGTCCAACAGCTGCTCCTCACAGTCATCAGCCAAGGATTGTTTCGGA
AACAAGCTCACCCAGCTTCCATCAGCTCCCAGCAGAGGGTTTTGAGCCCCCCAGACAACA
GCACCAACTCGTGCTTGTAGAAGTGCCCCTTGCACACATCGGACATGGCTCTAAGGTGAC
ATACAAAAGTTGAATCCGATTATGAGCT
■■Homology search results ■■ -
sp_hit_id Q9S7I0
Definition sp|Q9S7I0|Y1872_ARATH Uncharacterized protein At1g68720 OS=Arabidopsis thaliana
Align length 94
Score (bit) 74.7
E-value 1.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915014|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_E04.
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9S7I0|Y1872_ARATH Uncharacterized protein At1g68720 OS=Arabi... 75 1e-16
sp|P68397|TADA_SHIFL tRNA-specific adenosine deaminase OS=Shigel... 43 3e-06
sp|P68398|TADA_ECOLI tRNA-specific adenosine deaminase OS=Escher... 43 3e-06
sp|Q8FF24|TADA_ECOL6 tRNA-specific adenosine deaminase OS=Escher... 43 3e-06
sp|Q8XA44|TADA_ECO57 tRNA-specific adenosine deaminase OS=Escher... 43 3e-06
sp|Q7CQ08|TADA_SALTY tRNA-specific adenosine deaminase OS=Salmon... 39 5e-05
sp|Q8XGY4|TADA_SALTI tRNA-specific adenosine deaminase OS=Salmon... 39 5e-05
sp|P44931|TADA_HAEIN tRNA-specific adenosine deaminase OS=Haemop... 34 6e-04
sp|Q5XE14|TADA_STRP6 tRNA-specific adenosine deaminase OS=Strept... 33 0.018
sp|Q8K8Q9|TADA_STRP3 tRNA-specific adenosine deaminase OS=Strept... 33 0.018
sp|P68999|TADA_STRP1 tRNA-specific adenosine deaminase OS=Strept... 33 0.023
sp|Q8P2R7|Y196_STRP8 Uncharacterized deaminase spyM18_0196 OS=St... 33 0.024
sp|P21335|YAAJ_BACSU Uncharacterized deaminase yaaJ OS=Bacillus ... 34 0.35
sp|P53438|SOK2_YEAST Protein SOK2 OS=Saccharomyces cerevisiae GN... 33 0.78
sp|Q9RV23|TILS_DEIRA tRNA(Ile)-lysidine synthase OS=Deinococcus ... 32 1.7
sp|Q20010|SAS5_CAEEL Spindle assembly abnormal protein 5 OS=Caen... 31 2.9
sp|P16749|IE63_HCMVA Transcriptional regulator IE63 homolog OS=H... 31 2.9
sp|Q5SI38|TILS_THET8 tRNA(Ile)-lysidine synthase OS=Thermus ther... 31 3.8
sp|Q72IF6|TILS_THET2 tRNA(Ile)-lysidine synthase OS=Thermus ther... 31 3.8
sp|Q2UVX4|CO3_BOVIN Complement C3 OS=Bos taurus GN=C3 PE=1 SV=2 30 4.9
sp|Q2PC93|SSPO_CHICK SCO-spondin OS=Gallus gallus GN=SSPO PE=2 SV=1 30 6.6
sp|Q4V7V8|ADAT2_XENLA tRNA-specific adenosine deaminase 2 OS=Xen... 27 8.1
sp|Q0P4H0|ADAT2_XENTR tRNA-specific adenosine deaminase 2 OS=Xen... 27 8.1
sp|Q68Y02|Y819_RICTY Uncharacterized deaminase RT0819 OS=Rickett... 30 8.6
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 ... 30 8.6
sp|Q6ZUB1|CI079_HUMAN FAM75-like protein C9orf79 OS=Homo sapiens... 30 8.6

>sp|Q9S7I0|Y1872_ARATH Uncharacterized protein At1g68720
OS=Arabidopsis thaliana GN=At1g68720 PE=1 SV=1
Length = 1307

Score = 74.7 bits (182), Expect(2) = 1e-16
Identities = 40/94 (42%), Positives = 55/94 (58%), Gaps = 1/94 (1%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFP-KQSLADDCEEQLLDCEMKGAAKKRGLVH 273
GA+LQARV +VWGA N LLGADGSW+ LFP + + E K VH
Sbjct: 1194 GAILQARVNTLVWGAPNKLLGADGSWIRLFPGGEGNGSEASE-----------KPPPPVH 1242

Query: 272 PFNPNIRVRGGVLASDCSEITKDFFRR*RHESNK 171
PF+P + +R GVL S+C++ + FF+ R + +K
Sbjct: 1243 PFHPKMTIRRGVLESECAQTMQQFFQLRRKKKDK 1276



Score = 31.6 bits (70), Expect(2) = 1e-16
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPCPMCA
Sbjct: 1182 LYVTLEPCPMCA 1193


>sp|P68397|TADA_SHIFL tRNA-specific adenosine deaminase OS=Shigella
flexneri GN=tadA PE=3 SV=2
Length = 167

Score = 42.7 bits (99), Expect(2) = 3e-06
Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 4/103 (3%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA++ +R+G VV+GA++ GA GS + + L HP
Sbjct: 92 GAMIHSRIGRVVFGARDAKTGAAGSLMDV---------------------------LHHP 124

Query: 269 -FNPNIRVRGGVLASDCSEITKDFFRR*RHE---SNKAQTRTN 153
N + + G+LA +C+ + DFFR R E KAQ+ T+
Sbjct: 125 GMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD 167



Score = 28.1 bits (61), Expect(2) = 3e-06
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 80 LYVTLEPCVMCA 91


>sp|P68398|TADA_ECOLI tRNA-specific adenosine deaminase
OS=Escherichia coli (strain K12) GN=tadA PE=1 SV=2
Length = 167

Score = 42.7 bits (99), Expect(2) = 3e-06
Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 4/103 (3%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA++ +R+G VV+GA++ GA GS + + L HP
Sbjct: 92 GAMIHSRIGRVVFGARDAKTGAAGSLMDV---------------------------LHHP 124

Query: 269 -FNPNIRVRGGVLASDCSEITKDFFRR*RHE---SNKAQTRTN 153
N + + G+LA +C+ + DFFR R E KAQ+ T+
Sbjct: 125 GMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD 167



Score = 28.1 bits (61), Expect(2) = 3e-06
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 80 LYVTLEPCVMCA 91


>sp|Q8FF24|TADA_ECOL6 tRNA-specific adenosine deaminase
OS=Escherichia coli O6 GN=tadA PE=3 SV=2
Length = 167

Score = 42.7 bits (99), Expect(2) = 3e-06
Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 4/103 (3%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA++ +R+G VV+GA++ GA GS + + L HP
Sbjct: 92 GAMIHSRIGRVVFGARDAKTGAAGSLMDV---------------------------LHHP 124

Query: 269 -FNPNIRVRGGVLASDCSEITKDFFRR*RHE---SNKAQTRTN 153
N + + G+LA +C+ + DFFR R E KAQ+ T+
Sbjct: 125 GMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD 167



Score = 28.1 bits (61), Expect(2) = 3e-06
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 80 LYVTLEPCVMCA 91


>sp|Q8XA44|TADA_ECO57 tRNA-specific adenosine deaminase
OS=Escherichia coli O157:H7 GN=tadA PE=3 SV=2
Length = 167

Score = 42.7 bits (99), Expect(2) = 3e-06
Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 4/103 (3%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA++ +R+G VV+GA++ GA GS + + L HP
Sbjct: 92 GAMIHSRIGRVVFGARDAKTGAAGSLMDV---------------------------LHHP 124

Query: 269 -FNPNIRVRGGVLASDCSEITKDFFRR*RHE---SNKAQTRTN 153
N + + G+LA +C+ + DFFR R E KAQ+ T+
Sbjct: 125 GMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD 167



Score = 28.1 bits (61), Expect(2) = 3e-06
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 80 LYVTLEPCVMCA 91


>sp|Q7CQ08|TADA_SALTY tRNA-specific adenosine deaminase
OS=Salmonella typhimurium GN=tadA PE=3 SV=2
Length = 172

Score = 38.5 bits (88), Expect(2) = 5e-05
Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA++ +R+G VV+GA++ GA GS + + L HP
Sbjct: 92 GAMVHSRIGRVVFGARDAKTGAAGSLIDV---------------------------LHHP 124

Query: 269 -FNPNIRVRGGVLASDCSEITKDFFRR*RHE 180
N + + GVL +C+ + DFFR R E
Sbjct: 125 GMNHRVEIIEGVLRDECATLLSDFFRMRRQE 155



Score = 28.1 bits (61), Expect(2) = 5e-05
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 80 LYVTLEPCVMCA 91


>sp|Q8XGY4|TADA_SALTI tRNA-specific adenosine deaminase
OS=Salmonella typhi GN=tadA PE=3 SV=2
Length = 172

Score = 38.5 bits (88), Expect(2) = 5e-05
Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA++ +R+G VV+GA++ GA GS + + L HP
Sbjct: 92 GAMVHSRIGRVVFGARDAKTGAAGSLIDV---------------------------LHHP 124

Query: 269 -FNPNIRVRGGVLASDCSEITKDFFRR*RHE 180
N + + GVL +C+ + DFFR R E
Sbjct: 125 GMNHRVEIIEGVLRDECATLLSDFFRMRRQE 155



Score = 28.1 bits (61), Expect(2) = 5e-05
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 80 LYVTLEPCVMCA 91


>sp|P44931|TADA_HAEIN tRNA-specific adenosine deaminase
OS=Haemophilus influenzae GN=tadA PE=3 SV=1
Length = 173

Score = 34.3 bits (77), Expect(2) = 6e-04
Identities = 28/102 (27%), Positives = 41/102 (40%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+L +R+ +V+GA + GA GS F DD +
Sbjct: 96 GAILHSRIKRLVFGASDYKTGAIGSRFHFF------DD--------------------YK 129

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*RHESNKAQTRTNSYS 144
N + V GVLA +CS+ FF++ R E + S S
Sbjct: 130 MNHTLEVTSGVLAEECSQKLSTFFQKRREEKKIEKALLKSLS 171



Score = 28.5 bits (62), Expect(2) = 6e-04
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 84 LYVTLEPCTMCA 95


>sp|Q5XE14|TADA_STRP6 tRNA-specific adenosine deaminase
OS=Streptococcus pyogenes serotype M6 GN=tadA PE=1 SV=2
Length = 171

Score = 33.1 bits (74), Expect(2) = 0.018
Identities = 24/95 (25%), Positives = 38/95 (40%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+ AR+ V++GA N G S + + L
Sbjct: 92 GAIGLARIPHVIYGASNQKFGGADSLYQILTDERL------------------------- 126

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*RHESNKAQ 165
N ++V G+LA+DC+ I + FFR+ R A+
Sbjct: 127 -NHRVQVERGLLAADCANIMQTFFRQGRERKKIAK 160



Score = 24.6 bits (52), Expect(2) = 0.018
Identities = 8/12 (66%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
L+VT+EPC MC+
Sbjct: 80 LFVTIEPCVMCS 91


>sp|Q8K8Q9|TADA_STRP3 tRNA-specific adenosine deaminase
OS=Streptococcus pyogenes serotype M3 GN=tadA PE=3 SV=1
Length = 171

Score = 33.1 bits (74), Expect(2) = 0.018
Identities = 24/95 (25%), Positives = 38/95 (40%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+ AR+ V++GA N G S + + L
Sbjct: 92 GAIGLARIPHVIYGASNQKFGGADSLYQILTDERL------------------------- 126

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*RHESNKAQ 165
N ++V G+LA+DC+ I + FFR+ R A+
Sbjct: 127 -NHRVQVERGLLAADCANIMQTFFRQGRERKKIAK 160



Score = 24.6 bits (52), Expect(2) = 0.018
Identities = 8/12 (66%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
L+VT+EPC MC+
Sbjct: 80 LFVTIEPCVMCS 91


tr_hit_id A2YD38
Definition tr|A2YD38|A2YD38_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 101
Score (bit) 86.3
E-value 3.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915014|Adiantum capillus-veneris mRNA, clone:
YMU001_000065_E04.
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2YD38|A2YD38_ORYSI Putative uncharacterized protein OS=Oryza... 86 3e-18
tr|Q67VW4|Q67VW4_ORYSJ Os06g0489500 protein OS=Oryza sativa subs... 83 3e-17
tr|A3BBX5|A3BBX5_ORYSJ Putative uncharacterized protein OS=Oryza... 83 3e-17
tr|A7P2Z4|A7P2Z4_VITVI Chromosome chr1 scaffold_5, whole genome ... 79 5e-17
tr|A9RUL5|A9RUL5_PHYPA Predicted protein OS=Physcomitrella paten... 75 8e-16
tr|Q01BC2|Q01BC2_OSTTA Putative deaminase (ISS) OS=Ostreococcus ... 71 2e-14
tr|A4RVN1|A4RVN1_OSTLU Predicted protein OS=Ostreococcus lucimar... 72 6e-14
tr|A8HSU4|A8HSU4_CHLRE Predicted protein (Fragment) OS=Chlamydom... 63 9e-09
tr|B1XTX7|B1XTX7_POLNS CMP/dCMP deaminase zinc-binding OS=Polynu... 45 8e-06
tr|B8F489|B8F489_HAEPR tRNA-adenosine deaminase, cytosine/adenos... 44 1e-05
tr|B0QT34|B0QT34_HAEPR Putative uncharacterized protein OS=Haemo... 44 1e-05
tr|A1TRQ8|A1TRQ8_ACIAC CMP/dCMP deaminase, zinc-binding OS=Acido... 45 1e-05
tr|Q0T1W1|Q0T1W1_SHIF8 Putative deaminase OS=Shigella flexneri s... 44 2e-05
tr|A1W869|A1W869_ACISJ CMP/dCMP deaminase, zinc-binding OS=Acido... 44 2e-05
tr|B7D8M9|B7D8M9_9BURK CMP/dCMP deaminase zinc-binding OS=Diapho... 44 2e-05
tr|Q32D13|Q32D13_SHIDS Putative deaminase OS=Shigella dysenteria... 43 3e-05
tr|Q31XS8|Q31XS8_SHIBS Putative deaminase OS=Shigella boydii ser... 43 3e-05
tr|Q1R8H5|Q1R8H5_ECOUT Putative deaminase OS=Escherichia coli (s... 43 3e-05
tr|Q0TES9|Q0TES9_ECOL5 Putative uncharacterized protein OS=Esche... 43 3e-05
tr|B6I5D3|B6I5D3_ECOSE Putative deaminase OS=Escherichia coli (s... 43 3e-05
tr|B2TXX2|B2TXX2_SHIB3 tRNA-specific adenosine deaminase OS=Shig... 43 3e-05
tr|A8A367|A8A367_ECOHS tRNA-specific adenosine deaminase OS=Esch... 43 3e-05
tr|A1AE90|A1AE90_ECOK1 tRNA-specific adenosine deaminase OS=Esch... 43 3e-05
tr|B7MIP3|B7MIP3_ECOLX tRNA-specific adenosine deaminase OS=Esch... 43 3e-05
tr|B7LV06|B7LV06_ESCFE tRNA-specific adenosine deaminase OS=Esch... 43 3e-05
tr|B7LDF1|B7LDF1_ECOLX tRNA-specific adenosine deaminase OS=Esch... 43 3e-05
tr|B3WYI6|B3WYI6_SHIDY tRNA-specific adenosine deaminase OS=Shig... 43 3e-05
tr|B3HTM7|B3HTM7_ECOLX tRNA-specific adenosine deaminase OS=Esch... 43 3e-05
tr|B3BVE1|B3BVE1_ECO57 tRNA-specific adenosine deaminase OS=Esch... 43 3e-05
tr|B3BJ51|B3BJ51_ECO57 tRNA-specific adenosine deaminase OS=Esch... 43 3e-05

>tr|A2YD38|A2YD38_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23033 PE=4 SV=1
Length = 1593

Score = 86.3 bits (212), Expect(2) = 3e-18
Identities = 44/101 (43%), Positives = 61/101 (60%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+LQARV VVWGA N LLGADGSWV LFP + Q + + G VHP
Sbjct: 1476 GAILQARVDTVVWGAPNKLLGADGSWVRLFPG-------DGQTSSLDSANTNQGAGPVHP 1528

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*RHESNKAQTRTNSY 147
F+P I +R G+L+++CSEI + FF R + K ++ +++
Sbjct: 1529 FHPKISIRRGILSAECSEIMQQFFHLRRRKKQKPESPPHAH 1569



Score = 28.5 bits (62), Expect(2) = 3e-18
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 1464 LYVTLEPCAMCA 1475


>tr|Q67VW4|Q67VW4_ORYSJ Os06g0489500 protein OS=Oryza sativa subsp.
japonica GN=P0583E12.28 PE=4 SV=1
Length = 1590

Score = 83.2 bits (204), Expect(2) = 3e-17
Identities = 42/84 (50%), Positives = 53/84 (63%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+LQARV VVWGA N LLGADGSWV LFP + Q + + G VHP
Sbjct: 1474 GAILQARVDTVVWGAPNKLLGADGSWVRLFPG-------DGQTSSLDSANTNQGAGPVHP 1526

Query: 269 FNPNIRVRGGVLASDCSEITKDFF 198
F+P I +R G+L+++CSEI + FF
Sbjct: 1527 FHPKISIRRGILSAECSEIMQQFF 1550



Score = 28.5 bits (62), Expect(2) = 3e-17
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 1462 LYVTLEPCAMCA 1473


>tr|A3BBX5|A3BBX5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_020547 PE=4 SV=1
Length = 1528

Score = 83.2 bits (204), Expect(2) = 3e-17
Identities = 42/84 (50%), Positives = 53/84 (63%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+LQARV VVWGA N LLGADGSWV LFP + Q + + G VHP
Sbjct: 1412 GAILQARVDTVVWGAPNKLLGADGSWVRLFPG-------DGQTSSLDSANTNQGAGPVHP 1464

Query: 269 FNPNIRVRGGVLASDCSEITKDFF 198
F+P I +R G+L+++CSEI + FF
Sbjct: 1465 FHPKISIRRGILSAECSEIMQQFF 1488



Score = 28.5 bits (62), Expect(2) = 3e-17
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 1400 LYVTLEPCAMCA 1411


>tr|A7P2Z4|A7P2Z4_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030244001
PE=4 SV=1
Length = 198

Score = 79.3 bits (194), Expect(2) = 5e-17
Identities = 42/93 (45%), Positives = 55/93 (59%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+LQAR+ +VWGA N LLGADGSW+ LFP E L D K + HP
Sbjct: 81 GAILQARIDTLVWGAPNKLLGADGSWIRLFPNGGEGGSGSE-LTD-------KTQAPAHP 132

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*RHESNK 171
F+P + +R GVLAS+CS+ + FF+ R + K
Sbjct: 133 FHPKMTIRRGVLASECSDAMQQFFQLRRKQKEK 165



Score = 31.6 bits (70), Expect(2) = 5e-17
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPCPMCA
Sbjct: 69 LYVTLEPCPMCA 80


>tr|A9RUL5|A9RUL5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_70762 PE=4 SV=1
Length = 413

Score = 75.1 bits (183), Expect(2) = 8e-16
Identities = 41/96 (42%), Positives = 53/96 (55%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+LQ RV VVWGA+N LLGADGSW+ LFP S + K + +HP
Sbjct: 295 GAILQGRVSEVVWGARNSLLGADGSWIKLFPVSSSGEQ------------EPKCKDYLHP 342

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*RHESNKAQT 162
F+ I VR GVL +C +I + FF R + K +T
Sbjct: 343 FHRTITVRRGVLGEECGDIMQTFFAM-RRQQPKCRT 377



Score = 31.6 bits (70), Expect(2) = 8e-16
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPCPMCA
Sbjct: 283 LYVTLEPCPMCA 294


>tr|Q01BC2|Q01BC2_OSTTA Putative deaminase (ISS) OS=Ostreococcus
tauri GN=Ot04g01260 PE=4 SV=1
Length = 247

Score = 70.9 bits (172), Expect(2) = 2e-14
Identities = 38/85 (44%), Positives = 50/85 (58%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
G +LQARVG VV+GA+N LLGADGSWVS+ K D+ +A H
Sbjct: 158 GGILQARVGRVVYGAKNALLGADGSWVSVLRKSDAVDE------------SAATTTRPHA 205

Query: 269 FNPNIRVRGGVLASDCSEITKDFFR 195
F+P++ V GGVLA + + K+FFR
Sbjct: 206 FSPDLDVTGGVLAEETGALMKEFFR 230



Score = 31.2 bits (69), Expect(2) = 2e-14
Identities = 13/20 (65%), Positives = 14/20 (70%)
Frame = -2

Query: 504 HNRIQLLYVTLEPCPMCARG 445
H R +YVTLEPC MCA G
Sbjct: 140 HLRKTTMYVTLEPCAMCAGG 159


>tr|A4RVN1|A4RVN1_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_37349 PE=4 SV=1
Length = 170

Score = 72.4 bits (176), Expect(2) = 6e-14
Identities = 37/88 (42%), Positives = 53/88 (60%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+LQ+RVG V +GA+N LLGADGSW +L + ++ G+ + HP
Sbjct: 84 GAILQSRVGGVTYGARNALLGADGSWAALLRNE-------------DVGGSERAPVRAHP 130

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*R 186
F P++ V+GGVLA + E ++FFRR R
Sbjct: 131 FTPDLDVKGGVLAEETGEAMREFFRRRR 158



Score = 28.1 bits (61), Expect(2) = 6e-14
Identities = 11/18 (61%), Positives = 13/18 (72%)
Frame = -2

Query: 504 HNRIQLLYVTLEPCPMCA 451
H + +YVTLEPC MCA
Sbjct: 66 HLKRTRMYVTLEPCAMCA 83


>tr|A8HSU4|A8HSU4_CHLRE Predicted protein (Fragment)
OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_74200 PE=4
SV=1
Length = 143

Score = 62.8 bits (151), Expect = 9e-09
Identities = 35/86 (40%), Positives = 45/86 (52%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GAL+QARVG VV+GA+ P LGADGSW P HP
Sbjct: 83 GALMQARVGRVVYGARQPRLGADGSWAPPPPP--------------------------HP 116

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR 192
F+ +I V GG LA +C+++ + FFRR
Sbjct: 117 FHDSIVVEGGCLAEECADVMRAFFRR 142


>tr|B1XTX7|B1XTX7_POLNS CMP/dCMP deaminase zinc-binding
OS=Polynucleobacter necessarius (strain STIR1)
GN=Pnec_0542 PE=4 SV=1
Length = 152

Score = 45.4 bits (106), Expect(2) = 8e-06
Identities = 26/88 (29%), Positives = 41/88 (46%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+L AR+ VV+GA +P GA GS + LF + +
Sbjct: 91 GAMLHARIDRVVFGAPDPKTGAAGSVLDLFASKQI------------------------- 125

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*R 186
N V GG+++ +C ++ +DFF+R R
Sbjct: 126 -NHQTSVEGGIMSEECGQLLRDFFKRRR 152



Score = 27.3 bits (59), Expect(2) = 8e-06
Identities = 10/12 (83%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MC+
Sbjct: 79 LYVTLEPCAMCS 90


>tr|B8F489|B8F489_HAEPR tRNA-adenosine deaminase, cytosine/adenosine
deaminases OS=Haemophilus parasuis SH0165 GN=tadA PE=4
SV=1
Length = 157

Score = 43.9 bits (102), Expect(2) = 1e-05
Identities = 29/100 (29%), Positives = 44/100 (44%)
Frame = -3

Query: 449 GALLQARVGAVVWGAQNPLLGADGSWVSLFPKQSLADDCEEQLLDCEMKGAAKKRGLVHP 270
GA+L +R+G +V+GA + GA GS LF +
Sbjct: 82 GAILHSRIGRLVFGASDYKTGALGSRFHLFED--------------------------YK 115

Query: 269 FNPNIRVRGGVLASDCSEITKDFFRR*RHESNKAQTRTNS 150
N +++RGGV+A++CS+ FFR+ R E NS
Sbjct: 116 MNHFLQIRGGVMANECSQKISAFFRKRREEQKNQHVNYNS 155



Score = 28.5 bits (62), Expect(2) = 1e-05
Identities = 11/12 (91%), Positives = 11/12 (91%)
Frame = -2

Query: 486 LYVTLEPCPMCA 451
LYVTLEPC MCA
Sbjct: 70 LYVTLEPCTMCA 81