BP915070
Clone id YMU001_000066_B06
Library
Length 475
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000066_B06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCACAGGCTTGCAATCCGAGCACTTGAAAGAACATAAACTGGAAATACTTAAGATAGAGA
CCCGATTGCTTACAGTGAGAGGGTTGGAGTTTCCCTTCTATAAGCACTGGCCTCTAAGGT
AGGTCCATGTGGTAGTGTTTCTTTATGATATCTCAATAACTTCAGACAATTGGTTTTGTG
TTACAATTGTGTGGCATACGGCATGCTTTTACAGCTGTTGGTTGTCGAAAGCAAGTTGCT
GAAAGTAAGTGATTTACAGTAGTAACATAGTTCCCCAAAAACATCCACTTAAAAATTTGT
GTTCAAAGCATTGTTGGCATTGATAAATATTTGCGTGGGATGATCTATACGCTGCCATGT
CAGCTATTTCCCTACCGTTAGCATACAACCAATTAGCCCTTGGTGACATGGGCTACATCA
ATCCCTACCATGAGAGAGAGGGATACTCTTTTATGATATGAAACAACAGAATGAA
■■Homology search results ■■ -
sp_hit_id Q9Y048
Definition sp|Q9Y048|DTN1_CAEEL Dystrobrevin-1 OS=Caenorhabditis elegans
Align length 56
Score (bit) 29.6
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915070|Adiantum capillus-veneris mRNA, clone:
YMU001_000066_B06.
(455 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9Y048|DTN1_CAEEL Dystrobrevin-1 OS=Caenorhabditis elegans GN... 30 6.4

>sp|Q9Y048|DTN1_CAEEL Dystrobrevin-1 OS=Caenorhabditis elegans
GN=dyb-1 PE=1 SV=1
Length = 590

Score = 29.6 bits (65), Expect = 6.4
Identities = 15/56 (26%), Positives = 25/56 (44%)
Frame = -2

Query: 442 PSLSW*GLM*PMSPRANWLYANGREIADMAAYRSSHANIYQCQQCFEHKFLSGCFW 275
P + W L+ M+ +N + + D RS Y+CQ+C ++ CFW
Sbjct: 241 PCIMWLPLLHRMASVSNVYHP---VVCDACQVRSFTGFRYKCQRCANYQLCQSCFW 293


tr_hit_id A5AGN2
Definition tr|A5AGN2|A5AGN2_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 74
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915070|Adiantum capillus-veneris mRNA, clone:
YMU001_000066_B06.
(455 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5AGN2|A5AGN2_VITVI Putative uncharacterized protein OS=Vitis... 33 5.4
tr|B1D8B9|B1D8B9_9BACL PP-loop domain protein OS=Paenibacillus s... 33 9.3

>tr|A5AGN2|A5AGN2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024007 PE=4 SV=1
Length = 1144

Score = 33.5 bits (75), Expect = 5.4
Identities = 23/74 (31%), Positives = 37/74 (50%)
Frame = -3

Query: 324 INANNALNTNF*VDVFGELCYYCKSLTFSNLLSTTNSCKSMPYATQL*HKTNCLKLLRYH 145
++ NA+N+ V G L Y SLT ++ N + + H T +LLRY
Sbjct: 958 VDGTNAVNSTEYRRVIGSLQYL--SLTRPDIXFAVNKLSQFMHKPTVTHWTATKRLLRYL 1015

Query: 144 KETLPHGPTLEASA 103
K+T+ HG L+++A
Sbjct: 1016 KKTIFHGLHLKSAA 1029


>tr|B1D8B9|B1D8B9_9BACL PP-loop domain protein OS=Paenibacillus sp.
JDR-2 GN=Pjdr2DRAFT_1071 PE=4 SV=1
Length = 267

Score = 32.7 bits (73), Expect = 9.3
Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 2/88 (2%)
Frame = -3

Query: 267 CYYCKSLTFSNL--LSTTNSCKSMPYATQL*HKTNCLKLLRYHKETLPHGPTLEASAYRR 94
CY+CKS F +L L S ++ Y K ++ KE GP LEA Y++
Sbjct: 95 CYFCKSSLFDHLYPLLEERSFANLVYGVIADDKNEHRPGMQAAKERGVRGPLLEADLYKQ 154

Query: 93 ETPTLSL*AIGSLS*VFPVYVLSSARIA 10
E LS G + P + S+RIA
Sbjct: 155 EIRELSK-VFGLPTWDKPSFACLSSRIA 181