BP915110
Clone id YMU001_000066_F02
Library
Length 521
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000066_F02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GACCTAGTTAACACCTGTCTTGGCAATGGATACATGTCTTCCTTAAGGGTTGTTCACCCG
GTGGATATGGTGCTAATAGTTGAAGCTATGCTGGGAAAGAAGATGGAAGTGCAAGCATAT
GTGTATGGTGATGCCCAGGTGTGTGTCATGACCAAGGCTATAATGAAGGAAGAAGGAGTC
AAGATGTCAGTGAATGCTTCAATCCGTATGAGGATGGCCAACCACAAAAAGACAAGGTGT
CTTGGGATAATTGAAGATGTGAAGATAAAAGTCTTGGAGATTGAGTGCTTGGTTGATTGC
TATGTGATGCAAGCGGGTAAGAATGCTTATCCGATCATTTTAGGGAGGCCATGGCTTGTA
ACCCTTGGTGCTAAGCAAGATTGGGGCATGGACTTGATCACCATCCCCGACCAAGAGAAA
GAGAGGATCATTGTCTACAACATGAAGACACACAAGAGTCGTACATAGCCCCTATTGGAG
ATGCAAGATACAGATTCGATAGAAACTACGTTGTGAGCGGG
■■Homology search results ■■ -
sp_hit_id A6QC65
Definition sp|A6QC65|ISPG_SULNB 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase OS=Sulfurovum sp. (strain NBC37-1)
Align length 114
Score (bit) 30.4
E-value 5.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915110|Adiantum capillus-veneris mRNA, clone:
YMU001_000066_F02.
(521 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A6QC65|ISPG_SULNB 4-hydroxy-3-methylbut-2-en-1-yl diphosphate... 30 5.3
sp|Q99JT5|KRCC1_MOUSE Lysine-rich coiled-coil protein 1 OS=Mus m... 30 6.9
sp|Q6PCM2|INT6_MOUSE Integrator complex subunit 6 OS=Mus musculu... 30 6.9

>sp|A6QC65|ISPG_SULNB 4-hydroxy-3-methylbut-2-en-1-yl diphosphate
synthase OS=Sulfurovum sp. (strain NBC37-1) GN=ispG PE=3
SV=1
Length = 353

Score = 30.4 bits (67), Expect = 5.3
Identities = 31/114 (27%), Positives = 46/114 (40%), Gaps = 9/114 (7%)
Frame = +1

Query: 31 YMSSLRVVHPVDMVLIVEAMLGKKMEVQAYVYG------DAQVCVMTKAIMKEEGVKMSV 192
Y +L VD + +G+K ++ V +V V ++ KE K
Sbjct: 86 YRLALEAAKWVDCIRFNPGNIGEKSRIKEIVKACQERNLPIRVGVNAGSLEKEFDQKYGA 145

Query: 193 NASIRMRMA--NHKKTRCLGIIE-DVKIKVLEIECLVDCYVMQAGKNAYPIILG 345
A + A N K LG + V +K +++ VD Y M KNAYP LG
Sbjct: 146 TAEGMVASAEYNIKFLEDLGFTDIKVSLKASDVDRTVDAYRMLRPKNAYPFHLG 199


>sp|Q99JT5|KRCC1_MOUSE Lysine-rich coiled-coil protein 1 OS=Mus
musculus GN=Krcc1 PE=2 SV=1
Length = 256

Score = 30.0 bits (66), Expect = 6.9
Identities = 12/34 (35%), Positives = 22/34 (64%)
Frame = -2

Query: 325 HSYPLASHSNQPSTQSPRLLSSHLQLSQDTLSFC 224
HSYP + S+Q + P+ L +H ++ ++LS+C
Sbjct: 69 HSYPRSCSSSQTEDRVPQWLPAHDKIRLNSLSYC 102


>sp|Q6PCM2|INT6_MOUSE Integrator complex subunit 6 OS=Mus musculus
GN=Ints6 PE=2 SV=1
Length = 883

Score = 30.0 bits (66), Expect = 6.9
Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
Frame = +1

Query: 97 KKMEVQAYVYGDAQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCL-GIIEDVKIKV 273
KK+ QA + D + + K +++E G+K+ + S + MA+ K + L GI EDV ++
Sbjct: 457 KKLSQQAKIESDRVIGSVGKKVVQETGIKVR-SRSHGLSMAHRKGFQVLQGISEDVPHRL 515

Query: 274 LEI 282
L++
Sbjct: 516 LDL 518


tr_hit_id Q2R8K8
Definition tr|Q2R8K8|Q2R8K8_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica
Align length 110
Score (bit) 50.4
E-value 5.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915110|Adiantum capillus-veneris mRNA, clone:
YMU001_000066_F02.
(521 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2R8K8|Q2R8K8_ORYSJ Putative uncharacterized protein OS=Oryza... 50 5e-05
tr|A5BMP4|A5BMP4_VITVI Putative uncharacterized protein OS=Vitis... 49 1e-04
tr|Q7XKY4|Q7XKY4_ORYSJ OSJNBa0022F16.20 protein OS=Oryza sativa ... 49 2e-04
tr|Q2QPS2|Q2QPS2_ORYSJ Putative uncharacterized protein OS=Oryza... 48 3e-04
tr|Q6F2G0|Q6F2G0_ORYSJ Putative uncharacterized protein OSJNBa00... 48 3e-04
tr|Q75H42|Q75H42_ORYSJ Putative uncharacterized protein OSJNBa00... 47 4e-04
tr|A5BTS1|A5BTS1_VITVI Putative uncharacterized protein OS=Vitis... 47 6e-04
tr|Q53KJ4|Q53KJ4_ORYSJ Transposable element protein, putative, R... 47 7e-04
tr|Q10IC5|Q10IC5_ORYSJ Putative uncharacterized protein OS=Oryza... 47 7e-04
tr|Q8S5F9|Q8S5F9_ORYSA Putative uncharacterized protein OSJNBb00... 46 0.001
tr|Q8LM79|Q8LM79_ORYSJ Putative uncharacterized protein OSJNAa00... 46 0.001
tr|Q7XRT2|Q7XRT2_ORYSJ OSJNBa0042F21.11 protein OS=Oryza sativa ... 46 0.001
tr|Q33A54|Q33A54_ORYSJ Putative uncharacterized protein OS=Oryza... 46 0.001
tr|A5B8Q5|A5B8Q5_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|A5AHP7|A5AHP7_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|Q7XLB2|Q7XLB2_ORYSJ OSJNBa0011K22.17 protein OS=Oryza sativa ... 46 0.001
tr|Q6MWI2|Q6MWI2_ORYSA B1159F04.18 protein (OSIGBa0137O04.1 prot... 46 0.001
tr|Q84SQ2|Q84SQ2_ORYSJ Putative uncharacterized protein OSJNBb00... 45 0.002
tr|Q10IJ0|Q10IJ0_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.002
tr|A5C307|A5C307_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5BI15|A5BI15_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5BER9|A5BER9_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5BP84|A5BP84_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5B4Q4|A5B4Q4_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5AE03|A5AE03_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|Q8SB54|Q8SB54_ORYSJ Putative polyprotein OS=Oryza sativa subs... 45 0.003
tr|Q8LM20|Q8LM20_ORYSJ Putative uncharacterized protein OSJNAa00... 45 0.003
tr|Q6UUE9|Q6UUE9_ORYSJ Putative uncharacterized protein (Putativ... 45 0.003
tr|A7QK21|A7QK21_VITVI Chromosome chr16 scaffold_110, whole geno... 45 0.003
tr|A5BST5|A5BST5_VITVI Putative uncharacterized protein OS=Vitis... 45 0.003

>tr|Q2R8K8|Q2R8K8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=LOC_Os11g11840 PE=4 SV=1
Length = 491

Score = 50.4 bits (119), Expect = 5e-05
Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
Frame = +1

Query: 133 AQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIEDVKIKVLEIECLVDCYV-- 306
A V VM K + + + +R+++AN GI EDV +K+ + VD V
Sbjct: 300 ASVSVMPKDVFDKLNFTVLTPTPMRLQLANSSVRYPAGIAEDVPVKIRDFFIPVDFVVLD 359

Query: 307 MQAGKNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKERIIVYNMKTHK 456
M GK P+ILGRP+L T+GA D G I + KE + +T +
Sbjct: 360 MDTGKEK-PLILGRPFLSTVGANIDVGTGSIRLHINGKEEKFEFQPRTEQ 408


>tr|A5BMP4|A5BMP4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037259 PE=4 SV=1
Length = 1298

Score = 48.9 bits (115), Expect = 1e-04
Identities = 46/149 (30%), Positives = 70/149 (46%), Gaps = 10/149 (6%)
Frame = +1

Query: 73 LIVEAMLGKKMEVQAYVYGDAQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGII 252
LI+ M+G+K+ +A + A V ++ ++ K+ G+ SI + +A+ GII
Sbjct: 213 LIISVMIGRKVVEKALLDLGASVNLLPYSVYKQLGLGELKPTSITLSLADRPVKIPRGII 272

Query: 253 EDVKIKVLEIECLVDCYVMQAG-----KNAYPIILGRPWLVTLGAKQDW--GMDLITIPD 411
EDV ++V VD V+ N PIILGRP+L TL A + G+ +T +
Sbjct: 273 EDVLVQVDNFYYPVDFVVLDTDPLVKEANYVPIILGRPFLATLNAIINCRNGLMQLTFGN 332

Query: 412 QEKERIIVYNMK---THKSRT*PLLEMQD 489
E I Y K T + P MQD
Sbjct: 333 MTLELNIFYMSKKLITPEEEEGPKENMQD 361


>tr|Q7XKY4|Q7XKY4_ORYSJ OSJNBa0022F16.20 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0022F16.20 PE=4 SV=1
Length = 444

Score = 48.5 bits (114), Expect = 2e-04
Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
Frame = +1

Query: 133 AQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIEDVKIKVLEIECLVDCYV-- 306
A V VM K + + + +R+++A+ GI EDV +K+ + LVD +
Sbjct: 323 ASVSVMPKDVFDKLNFTVLAPTPMRLQLADSSVYYSAGIAEDVPVKIRDFFILVDFVMLD 382

Query: 307 MQAGKNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKE 423
M GK P+ILGR +L T GA D GM +I KE
Sbjct: 383 MDTGKET-PLILGRTFLSTAGANIDVGMGIICFHINGKE 420


>tr|Q2QPS2|Q2QPS2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=LOC_Os12g33490 PE=4 SV=1
Length = 453

Score = 48.1 bits (113), Expect = 3e-04
Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
Frame = +1

Query: 133 AQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIEDVKIKVLEIECLVDCYVM- 309
A V VM K + + + IR+++A+ GI EDV +K+ ++ VD V+
Sbjct: 280 ASVSVMPKDVFDKLNFTVLALTPIRLQLADSSVRYPAGIAEDVLVKIRDLFIPVDFVVLD 339

Query: 310 -QAGKNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKERIIVYNMKTHK 456
+ GK +ILGRP+L T GA D GM I KE + +T +
Sbjct: 340 IETGKETL-LILGRPFLSTAGANIDVGMGSIRFHINRKEEKFEFQPRTEQ 388


>tr|Q6F2G0|Q6F2G0_ORYSJ Putative uncharacterized protein
OSJNBa0083K01.26 (Zinc knuckle family protein) OS=Oryza
sativa subsp. japonica GN=OSJNBa0083K01.26 PE=4 SV=1
Length = 585

Score = 47.8 bits (112), Expect = 3e-04
Identities = 37/127 (29%), Positives = 55/127 (43%), Gaps = 1/127 (0%)
Frame = +1

Query: 79 VEAMLGKKMEVQAYVYGDAQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIED 258
+ +G + QA A V VM K + + +R++MA+ GI ED
Sbjct: 365 ITCSIGAQQFDQALCDLGASVSVMPKDVFDRLNFTVLAPTPMRLQMADSSVRYQAGIAED 424

Query: 259 VKIKVLEIECLVDCYVMQAG-KNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKERIIV 435
V IK+ + VD V+ + P+ILGRP+L T GA D I EKE
Sbjct: 425 VPIKIWDFFIPVDFVVLDMDTRKETPLILGRPFLSTAGANIDVETSSICFHINEKEEKFE 484

Query: 436 YNMKTHK 456
+ +T +
Sbjct: 485 FQPRTEQ 491


>tr|Q75H42|Q75H42_ORYSJ Putative uncharacterized protein
OSJNBa0006O14.11 (Putative uncharacterized protein
OSJNBa0010H19.4) OS=Oryza sativa subsp. japonica
GN=OSJNBa0006O14.11 PE=4 SV=1
Length = 256

Score = 47.4 bits (111), Expect = 4e-04
Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 2/128 (1%)
Frame = +1

Query: 79 VEAMLGKKMEVQAYVYGDAQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIED 258
+ +G + V A A V VM K + + + + +++A+ GI+ED
Sbjct: 52 ITCSIGAQQFVHALCDLGASVSVMPKNVFDKLNFMVLAPTPMCLQLADSSVRYPAGIVED 111

Query: 259 VKIKVLEIECLVDCYV--MQAGKNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKERII 432
V +K+ VD V M GK P+ILGRP+L T GA D G I+ KE
Sbjct: 112 VPVKIRNFFIPVDFVVLDMDMGKET-PLILGRPFLSTAGANSDVGTGSISFHINGKELKF 170

Query: 433 VYNMKTHK 456
+ +T +
Sbjct: 171 EFQPRTEQ 178


>tr|A5BTS1|A5BTS1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013032 PE=4 SV=1
Length = 495

Score = 47.0 bits (110), Expect = 6e-04
Identities = 38/132 (28%), Positives = 64/132 (48%), Gaps = 7/132 (5%)
Frame = +1

Query: 73 LIVEAMLGKKMEVQAYVYGDAQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGII 252
L + M+G+K+ +A + A V ++ ++ K+ G+ S+ + +A+ G+I
Sbjct: 264 LTISVMIGEKLVEKALLDLGASVNLLAYSVYKQLGLGELKPTSVTLSLADRSMKIPRGMI 323

Query: 253 EDVKIKVLEIECLVDCYVMQA-----GKNAYPIILGRPWLVTLGAKQDW--GMDLITIPD 411
EDV ++V VD V+ G N PIILGRP+L T A ++ G+ +T +
Sbjct: 324 EDVLVQVDNFYYPVDFVVLDTDPIVKGTNYVPIILGRPFLATSNAIINYRNGLMQLTFGN 383

Query: 412 QEKERIIVYNMK 447
E I Y K
Sbjct: 384 MTFELNIFYMYK 395


>tr|Q53KJ4|Q53KJ4_ORYSJ Transposable element protein, putative,
Retrotrans_gag OS=Oryza sativa subsp. japonica
GN=LOC_Os11g26000 PE=4 SV=1
Length = 689

Score = 46.6 bits (109), Expect = 7e-04
Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 2/110 (1%)
Frame = +1

Query: 133 AQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIEDVKIKVLEIECLVDCYV-- 306
A V VM K + + + +R+++A+ GI EDV +K+ + VD V
Sbjct: 482 ASVSVMPKDVFDKLKFTVLAPTPMRLQLADSSVRYPAGIAEDVPVKIRDFFTPVDFVVLD 541

Query: 307 MQAGKNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKERIIVYNMKTHK 456
M GK P+ILGRP+L T GA D G I KE + +T +
Sbjct: 542 MDTGKET-PLILGRPFLSTGGANIDMGTGSIHFHINRKEERFEFQPRTEQ 590


>tr|Q10IC5|Q10IC5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=LOC_Os03g35769 PE=4 SV=1
Length = 700

Score = 46.6 bits (109), Expect = 7e-04
Identities = 37/118 (31%), Positives = 54/118 (45%), Gaps = 2/118 (1%)
Frame = +1

Query: 133 AQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIEDVKIKVLEIECLVDCYV-- 306
A V +M K I + + +R+++A+ I EDV +K+ VD V
Sbjct: 320 ASVSIMPKDIFDKLNFTVLAPTPMRLQLADSSVRYPAWIAEDVPVKIQNFFIPVDFVVLN 379

Query: 307 MQAGKNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKERIIVYNMKTHKSRT*PLLE 480
M GK P+ILGR +L T G D GM+ I KE + ++T + PLLE
Sbjct: 380 MDMGKET-PLILGRLFLSTAGVNIDVGMESICFYINGKEEKFEFQLRTEQCFMEPLLE 436


>tr|Q8S5F9|Q8S5F9_ORYSA Putative uncharacterized protein
OSJNBb0047B19.5 OS=Oryza sativa GN=OSJNBb0047B19.5 PE=4
SV=1
Length = 276

Score = 46.2 bits (108), Expect = 0.001
Identities = 37/128 (28%), Positives = 58/128 (45%), Gaps = 2/128 (1%)
Frame = +1

Query: 79 VEAMLGKKMEVQAYVYGDAQVCVMTKAIMKEEGVKMSVNASIRMRMANHKKTRCLGIIED 258
+ +G + QA A V VM K + + + +R+++A+ +GI ED
Sbjct: 144 ITCSIGAQQFDQALCDLGASVSVMPKDVFDKLNFTVLAPTPMRLQLADSSVHCPVGIEED 203

Query: 259 VKIKVLEIECLVDCYV--MQAGKNAYPIILGRPWLVTLGAKQDWGMDLITIPDQEKERII 432
V +K+ + VD V M GK +ILG P+L T GA D GM I KE
Sbjct: 204 VPVKIWDFFIPVDFVVLDMDTGKET-SLILGHPFLSTAGANIDVGMGSIRFHINGKEEKF 262

Query: 433 VYNMKTHK 456
+ ++T +
Sbjct: 263 EFQLRTEQ 270