BP915131
Clone id YMU001_000066_H05
Library
Length 491
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000066_H05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AACTGGATTTATTGATTCTGGATAGTGTGTATTCGAGCCCACCGTTATCTTGAATTGATA
GTGCACTGTTTTTGCGGCACTGCTTAGCCGAGATGCAGCTGCGCCAGTTGACGCTGTCAA
TATGACTGTCTTGTCTCGTTGTACGAACCTGGTCGTCATGTATTTGATGAGGAAGGACTT
TCTCGATCCTGGGACAACCGTGATAATGTGGAGGCCGGATGTTCTGGTGATGTGTCTTCA
AAAATCTTGTGTTGTTCAGGAGTGAGTGTTGCGTTACGGACATCGGCGAACTCCTTTAGA
AGCTGCAGCATGTTATGTCTACTAGTTTCCTTTGTATCATTTATCTCTACACGGCTTGAA
TGAATCGGACTCTCGCGGTTCAGGAAGAGCTTCTGGTGGATCAAGTTCACAATGTGCCCC
GTGTTCTCGTTTAAAAGCATGTTTCGTTGTGTGTACTCGTTGATGTACATCTCAAGGTTC
TCCTCGTCTCT
■■Homology search results ■■ -
sp_hit_id Q4PHC3
Definition sp|Q4PHC3|MVP1_USTMA Sorting nexin MVP1 OS=Ustilago maydis
Align length 93
Score (bit) 37.0
E-value 0.049
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915131|Adiantum capillus-veneris mRNA, clone:
YMU001_000066_H05.
(491 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4PHC3|MVP1_USTMA Sorting nexin MVP1 OS=Ustilago maydis GN=MV... 37 0.049
sp|Q9FGZ4|WRK48_ARATH Probable WRKY transcription factor 48 OS=A... 36 0.083
sp|Q8VBU2|NDRG2_RAT Protein NDRG2 OS=Rattus norvegicus GN=Ndrg2 ... 33 0.92
sp|O68007|BACB_BACLI Bacitracin synthetase 2 OS=Bacillus licheni... 32 1.6
sp|Q9QYG0|NDRG2_MOUSE Protein NDRG2 OS=Mus musculus GN=Ndrg2 PE=... 32 2.0
sp|B1YKW2|FENR1_EXIS2 Ferredoxin--NADP reductase 1 OS=Exiguobact... 32 2.0
sp|Q0UY53|ATG26_PHANO Sterol 3-beta-glucosyltransferase OS=Phaeo... 32 2.0
sp|Q5YTJ4|SYD_NOCFA Aspartyl-tRNA synthetase OS=Nocardia farcini... 31 2.7
sp|Q5RFI8|PGM2_PONAB Phosphoglucomutase-2 OS=Pongo abelii GN=PGM... 31 2.7
sp|Q96G03|PGM2_HUMAN Phosphoglucomutase-2 OS=Homo sapiens GN=PGM... 31 2.7
sp|Q8K070|SAM14_MOUSE Sterile alpha motif domain-containing prot... 31 3.5
sp|Q8IZD0|SAM14_HUMAN Sterile alpha motif domain-containing prot... 31 3.5
sp|Q5RBN6|NDRG2_PONAB Protein NDRG2 OS=Pongo abelii GN=NDRG2 PE=... 31 3.5
sp|A5A6K6|NDRG2_PANTR Protein NDRG2 OS=Pan troglodytes GN=NDRG2 ... 31 3.5
sp|Q9UN36|NDRG2_HUMAN Protein NDRG2 OS=Homo sapiens GN=NDRG2 PE=... 31 3.5
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida... 30 4.5
sp|Q4R4K0|NDRG2_MACFA Protein NDRG2 OS=Macaca fascicularis GN=ND... 30 4.5
sp|Q9BG76|EDN1_SHEEP Endothelin-1 OS=Ovis aries GN=EDN1 PE=2 SV=1 30 4.5
sp|O23878|13S1_FAGES 13S globulin seed storage protein 1 OS=Fago... 30 4.5
sp|O94751|BUB1_SCHPO Checkpoint serine/threonine-protein kinase ... 30 5.9
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Maca... 30 5.9
sp|P87237|YC0C_SCHPO Uncharacterized RING finger protein C4G3.12... 30 7.8

>sp|Q4PHC3|MVP1_USTMA Sorting nexin MVP1 OS=Ustilago maydis GN=MVP1
PE=3 SV=1
Length = 683

Score = 37.0 bits (84), Expect = 0.049
Identities = 32/93 (34%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
Frame = -1

Query: 320 RHNMLQLLKEFADVRNATLTPEQHKIFEDTSPEHPASTLSRLSQ-DRESPSSSNT*RPGS 144
R M L D+ +ATL P H F T+P P+ R S RE N GS
Sbjct: 128 RLTMGSLSAPVLDLSDATLNPHSHHTFPPTAPSGPSRIDPRPSTFMREMSDPWNANSSGS 187

Query: 143 YN--ETRQSY*QRQLAQLHLG*AVPQKQCTINS 51
YN +TR +Y Q A+PQ+ T+NS
Sbjct: 188 YNGIDTRPAYNQYD--------AMPQQYDTLNS 212


>sp|Q9FGZ4|WRK48_ARATH Probable WRKY transcription factor 48
OS=Arabidopsis thaliana GN=WRKY48 PE=2 SV=1
Length = 399

Score = 36.2 bits (82), Expect = 0.083
Identities = 21/67 (31%), Positives = 34/67 (50%)
Frame = -1

Query: 359 SSRVEINDTKETSRHNMLQLLKEFADVRNATLTPEQHKIFEDTSPEHPASTLSRLSQDRE 180
SS + + +S H+ L+L + + + + P + FED S +P S L L QD +
Sbjct: 44 SSSSNMANLVTSSDHHPLELAGNLSSIFDTSSLPFPYSYFEDHSSNNPNSFLDLLRQDHQ 103

Query: 179 SPSSSNT 159
SSSN+
Sbjct: 104 FASSSNS 110


>sp|Q8VBU2|NDRG2_RAT Protein NDRG2 OS=Rattus norvegicus GN=Ndrg2
PE=1 SV=1
Length = 371

Score = 32.7 bits (73), Expect = 0.92
Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 3/121 (2%)
Frame = -1

Query: 482 ENLEMYINEYTQRNMLLNENTGHIVNLIHQKLFLNRESPIHSSRVEINDTKETSRHNMLQ 303
EN+E+Y N Y R L E G + L + ++P + VE N + ++ + L+
Sbjct: 228 ENIELYWNSYNNRRDLNFERGGEMTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLK 287

Query: 302 LLKEFAD---VRNATLTPEQHKIFEDTSPEHPASTLSRLSQDRESPSSSNT*RPGSYNET 132
+ + LT E K F +S ++RLS+ R + +S GS + +
Sbjct: 288 MADSGGQPQLTQPGKLT-EAFKYFVQGMGYMASSCMTRLSRSRTASLTSAASIDGSRSRS 346

Query: 131 R 129
R
Sbjct: 347 R 347


>sp|O68007|BACB_BACLI Bacitracin synthetase 2 OS=Bacillus
licheniformis GN=bacB PE=3 SV=1
Length = 2607

Score = 32.0 bits (71), Expect = 1.6
Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 10/75 (13%)
Frame = -1

Query: 356 SRVEINDTKETSRHNMLQLLKEFADVRNATLTP-------EQHKI---FEDTSPEHPAST 207
+R+ +T ET + + +L++ +D TL E+H + F DT+ EHP+
Sbjct: 1492 TRLYKKETAETLAQHFVNILRDISDHPQKTLNDISMLSEEERHTVLYQFNDTNTEHPSGI 1551

Query: 206 LSRLSQDRESPSSSN 162
S L +++ S ++
Sbjct: 1552 FSELFEEQAEKSPNH 1566


>sp|Q9QYG0|NDRG2_MOUSE Protein NDRG2 OS=Mus musculus GN=Ndrg2 PE=1
SV=1
Length = 371

Score = 31.6 bits (70), Expect = 2.0
Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 3/121 (2%)
Frame = -1

Query: 482 ENLEMYINEYTQRNMLLNENTGHIVNLIHQKLFLNRESPIHSSRVEINDTKETSRHNMLQ 303
EN+E+Y N Y R L E G L + ++P + VE N + ++ + L+
Sbjct: 228 ENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLK 287

Query: 302 LLKEFAD---VRNATLTPEQHKIFEDTSPEHPASTLSRLSQDRESPSSSNT*RPGSYNET 132
+ + LT E K F +S ++RLS+ R + +S GS + +
Sbjct: 288 MADSGGQPQLTQPGKLT-EAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASIDGSRSRS 346

Query: 131 R 129
R
Sbjct: 347 R 347


>sp|B1YKW2|FENR1_EXIS2 Ferredoxin--NADP reductase 1
OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM
13490 / 255-15) GN=Exig_2313 PE=3 SV=1
Length = 331

Score = 31.6 bits (70), Expect = 2.0
Identities = 19/50 (38%), Positives = 26/50 (52%)
Frame = -3

Query: 171 LIKYMTTRFVQRDKTVILTASTGAAASRLSSAAKTVHYQFKITVGSNTHY 22
LI+ +T + KTVILTA G+ A+R A ++ GSN HY
Sbjct: 97 LIRLVTNKGEHYTKTVILTAGNGSFAARPLGVADAERFE-----GSNLHY 141


>sp|Q0UY53|ATG26_PHANO Sterol 3-beta-glucosyltransferase
OS=Phaeosphaeria nodorum GN=ATG26 PE=3 SV=1
Length = 1453

Score = 31.6 bits (70), Expect = 2.0
Identities = 24/84 (28%), Positives = 37/84 (44%)
Frame = -1

Query: 443 NMLLNENTGHIVNLIHQKLFLNRESPIHSSRVEINDTKETSRHNMLQLLKEFADVRNATL 264
+ +LN + IH + E P ++R + T+ + LQLL + N +L
Sbjct: 608 SQILNRSDVFRAPAIHSAGVSHSERPQQAARHSQDTTRSSGADQHLQLLVRPSKQTNTSL 667

Query: 263 TPEQHKIFEDTSPEHPASTLSRLS 192
P + EDT P+ TL RLS
Sbjct: 668 LPASTEAEEDTD---PSQTLPRLS 688


>sp|Q5YTJ4|SYD_NOCFA Aspartyl-tRNA synthetase OS=Nocardia farcinica
GN=aspS PE=3 SV=1
Length = 597

Score = 31.2 bits (69), Expect = 2.7
Identities = 21/68 (30%), Positives = 30/68 (44%)
Frame = -1

Query: 464 INEYTQRNMLLNENTGHIVNLIHQKLFLNRESPIHSSRVEINDTKETSRHNMLQLLKEFA 285
+NE L+E G L H+ L L RE P H+ R+ +K + + EF
Sbjct: 101 LNESAPLPFQLDEQPGEEARLKHRYLDLRREGPAHAIRLR---SKVNAAAREVLARHEFV 157

Query: 284 DVRNATLT 261
+V TLT
Sbjct: 158 EVETPTLT 165


>sp|Q5RFI8|PGM2_PONAB Phosphoglucomutase-2 OS=Pongo abelii GN=PGM2
PE=2 SV=3
Length = 612

Score = 31.2 bits (69), Expect = 2.7
Identities = 14/35 (40%), Positives = 20/35 (57%)
Frame = -3

Query: 468 VHQRVHTTKHAFKREHGAHCELDPPEALPEPRESD 364
VH VH H+F + +L PPEA+PE ++ D
Sbjct: 251 VHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPD 285


>sp|Q96G03|PGM2_HUMAN Phosphoglucomutase-2 OS=Homo sapiens GN=PGM2
PE=1 SV=4
Length = 612

Score = 31.2 bits (69), Expect = 2.7
Identities = 14/35 (40%), Positives = 20/35 (57%)
Frame = -3

Query: 468 VHQRVHTTKHAFKREHGAHCELDPPEALPEPRESD 364
VH VH H+F + +L PPEA+PE ++ D
Sbjct: 251 VHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPD 285


tr_hit_id A8JJJ7
Definition tr|A8JJJ7|A8JJJ7_CHLRE Predicted protein (Fragment) OS=Chlamydomonas reinhardtii
Align length 62
Score (bit) 54.3
E-value 3.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915131|Adiantum capillus-veneris mRNA, clone:
YMU001_000066_H05.
(491 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8JJJ7|A8JJJ7_CHLRE Predicted protein (Fragment) OS=Chlamydom... 54 3e-06
tr|B1B8N5|B1B8N5_CLOBO Helicase, RecD/TraA family OS=Clostridium... 44 0.004
tr|B0S3H7|B0S3H7_FINM2 ATP-dependent exodeoxyribonuclease alpha ... 44 0.005
tr|A4XG10|A4XG10_CALS8 ATP-dependent DNA helicase, RecD/TraA fam... 44 0.005
tr|B6Y5W8|B6Y5W8_ANATH Helicase, RecD/TraA family OS=Anaerocellu... 44 0.005
tr|A0Q2Y3|A0Q2Y3_CLONN Helicase, RecD/TraA family OS=Clostridium... 42 0.012
tr|Q2JCR4|Q2JCR4_FRASC Helicase RecD/TraA OS=Frankia sp. (strain... 41 0.034
tr|Q97F87|Q97F87_CLOAB ATP-dependent exoDNAse (Exonuclease V), a... 40 0.058
tr|A5N3G4|A5N3G4_CLOK5 Predicted exodeoxyribonuclease OS=Clostri... 40 0.058
tr|B6FVX7|B6FVX7_9CLOT Putative uncharacterized protein OS=Clost... 40 0.076
tr|B2UZL1|B2UZL1_CLOBA Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|B2TK11|B2TK11_CLOBB Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|B1KSU0|B1KSU0_CLOBM Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|B1IE46|B1IE46_CLOBK Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|A8LH98|A8LH98_FRASN Helicase, RecD/TraA family OS=Frankia sp.... 39 0.099
tr|A7G9S2|A7G9S2_CLOBL Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|A7FQI9|A7FQI9_CLOB1 Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|A5HY63|A5HY63_CLOBH Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|B1QIK7|B1QIK7_CLOBO Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|B1Q8N2|B1Q8N2_CLOBO Helicase, RecD/TraA family OS=Clostridium... 39 0.099
tr|B0A7Z6|B0A7Z6_9CLOT Putative uncharacterized protein OS=Clost... 39 0.13
tr|A5Z851|A5Z851_9FIRM Putative uncharacterized protein OS=Eubac... 39 0.13
tr|A3DHM2|A3DHM2_CLOTH ATP-dependent DNA helicase, RecD/TraA fam... 39 0.17
tr|B5GV46|B5GV46_STRCL Exodeoxyribonuclease V OS=Streptomyces cl... 38 0.22
tr|Q898W6|Q898W6_CLOTE Exodeoxyribonuclease V alpha chain OS=Clo... 38 0.29
tr|Q18CM1|Q18CM1_CLOD6 Putative DNA-binding protein OS=Clostridi... 38 0.29
tr|A8LYJ0|A8LYJ0_SALAI Helicase, RecD/TraA family OS=Salinispora... 38 0.29
tr|A4X1G5|A4X1G5_SALTO Helicase, RecD/TraA family OS=Salinispora... 37 0.38
tr|B1R2K6|B1R2K6_CLOBU Helicase, RecD/TraA family OS=Clostridium... 37 0.38
tr|Q8R8A3|Q8R8A3_THETN ATP-dependent exoDNAse (Exonuclease V), a... 37 0.49

>tr|A8JJJ7|A8JJJ7_CHLRE Predicted protein (Fragment)
OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_181173 PE=4
SV=1
Length = 301

Score = 54.3 bits (129), Expect = 3e-06
Identities = 30/62 (48%), Positives = 41/62 (66%)
Frame = -3

Query: 219 SGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSAAKTVHYQFKITV 40
+G+ ++T PGS K+F K +T + Q KTV+LTASTGAAA RLS+ A T H F +
Sbjct: 110 AGVIVLTGGPGSGKTFTTKKLTRQLRQMGKTVMLTASTGAAAVRLSAFATTNHGAFDLPS 169

Query: 39 GS 34
G+
Sbjct: 170 GN 171


>tr|B1B8N5|B1B8N5_CLOBO Helicase, RecD/TraA family OS=Clostridium
botulinum C str. Eklund GN=CBC_0743 PE=4 SV=1
Length = 735

Score = 43.9 bits (102), Expect = 0.004
Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 4/57 (7%)
Frame = -3

Query: 219 SGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSA----AKTVH 61
SG+ IIT PG+ K+ +IK +T F TV + A TG AA R+S A +KT+H
Sbjct: 333 SGIEIITGGPGTGKTTIIKCITEIFENASMTVFMAAPTGRAAKRMSEATGRESKTIH 389


>tr|B0S3H7|B0S3H7_FINM2 ATP-dependent exodeoxyribonuclease alpha
subunit OS=Finegoldia magna (strain ATCC 29328)
GN=FMG_1499 PE=4 SV=1
Length = 743

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 4/58 (6%)
Frame = -3

Query: 222 TSGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSA----AKTVH 61
T + IIT PG+ K+ +I +T F DK +IL A TG AA RLS + AKT+H
Sbjct: 328 TEKMLIITGGPGTGKTTIINNITKIFKNNDKEIILAAPTGRAAKRLSESCNEEAKTIH 385


>tr|A4XG10|A4XG10_CALS8 ATP-dependent DNA helicase, RecD/TraA family
OS=Caldicellulosiruptor saccharolyticus (strain ATCC
43494 / DSM 8903) GN=Csac_0197 PE=4 SV=1
Length = 741

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 4/65 (6%)
Frame = -3

Query: 222 TSGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRL----SSAAKTVHYQ 55
T G+ +IT PG+ K+ +IK + F Q K V L A TG AA R+ AKT+H
Sbjct: 332 TQGVSVITGGPGTGKTTIIKCIIEIFEQEGKKVFLCAPTGRAAKRMQQQCEKEAKTIHRL 391

Query: 54 FKITV 40
++TV
Sbjct: 392 LEMTV 396


>tr|B6Y5W8|B6Y5W8_ANATH Helicase, RecD/TraA family OS=Anaerocellum
thermophilum DSM 6725 GN=AtheDRAFT_2871 PE=4 SV=1
Length = 692

Score = 43.5 bits (101), Expect = 0.005
Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 4/65 (6%)
Frame = -3

Query: 222 TSGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSA----AKTVHYQ 55
T G+ IIT PG+ K+ +IK + F K V L A TG AA R+ +A +KT+H
Sbjct: 283 TQGVSIITGGPGTGKTTIIKCIIQIFEGEGKKVFLCAPTGRAAKRMQAACERESKTIHRL 342

Query: 54 FKITV 40
+ITV
Sbjct: 343 LEITV 347


>tr|A0Q2Y3|A0Q2Y3_CLONN Helicase, RecD/TraA family OS=Clostridium
novyi (strain NT) GN=NT01CX_0515 PE=4 SV=1
Length = 735

Score = 42.4 bits (98), Expect = 0.012
Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
Frame = -3

Query: 216 GLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSA----AKTVH 61
G+ IIT PG+ K+ +IK +T F TV + A TG AA R+S A +KT+H
Sbjct: 334 GIEIITGGPGTGKTTIIKCITEIFENASMTVFMAAPTGRAAKRMSEATGRESKTIH 389


>tr|Q2JCR4|Q2JCR4_FRASC Helicase RecD/TraA OS=Frankia sp. (strain
CcI3) GN=Francci3_1552 PE=4 SV=1
Length = 739

Score = 40.8 bits (94), Expect = 0.034
Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
Frame = -3

Query: 222 TSGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSS----AAKTVHYQ 55
TS + ++T PG KSF ++ + T + R VIL A TG AA RL+ A TVH
Sbjct: 353 TSRVAVLTGGPGCGKSFTVRSIVTLALARQAKVILAAPTGRAAKRLTELTGHEASTVHRL 412

Query: 54 FKITVGSNTHY 22
++ G + +
Sbjct: 413 LELRPGGDAAF 423


>tr|Q97F87|Q97F87_CLOAB ATP-dependent exoDNAse (Exonuclease V),
alpha subunit, RecD OS=Clostridium acetobutylicum
GN=recD PE=4 SV=1
Length = 739

Score = 40.0 bits (92), Expect = 0.058
Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
Frame = -3

Query: 222 TSGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSA----AKTVHYQ 55
++G+ +IT PG+ K+ +I+ +T F + + V + A TG AA R+S + AKT+H
Sbjct: 333 SNGIEVITGGPGTGKTTIIRCITYIFEELNMKVFMAAPTGRAAKRMSESTGREAKTIHRM 392

Query: 54 FKI 46
++
Sbjct: 393 LEL 395


>tr|A5N3G4|A5N3G4_CLOK5 Predicted exodeoxyribonuclease
OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 /
NCIMB 10680) GN=CKL_3670 PE=4 SV=1
Length = 750

Score = 40.0 bits (92), Expect = 0.058
Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 4/67 (5%)
Frame = -3

Query: 219 SGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSA----AKTVHYQF 52
+ + IIT PG+ K+ +I M F + + V++ A TG AA R+S A AKT+H
Sbjct: 333 NSVEIITGGPGTGKTTIINCMIQLFEKSNLKVLMAAPTGRAAKRMSEATKREAKTIHRLL 392

Query: 51 KITVGSN 31
+I V S+
Sbjct: 393 EIGVESD 399


>tr|B6FVX7|B6FVX7_9CLOT Putative uncharacterized protein
OS=Clostridium hiranonis DSM 13275 GN=CLOHIR_00026 PE=4
SV=1
Length = 739

Score = 39.7 bits (91), Expect = 0.076
Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 4/57 (7%)
Frame = -3

Query: 219 SGLHIITVVPGSRKSFLIKYMTTRFVQRDKTVILTASTGAAASRLSSA----AKTVH 61
SG+ +IT PG+ K+ I + F ++ K V+L A TG AA R+S AKT+H
Sbjct: 334 SGVSVITGGPGTGKTTTINTIIKIFKRQKKEVVLAAPTGRAAKRMSETSNEEAKTIH 390