BP915141
Clone id YMU001_000067_A04
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_A04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTGTTTTTTTTTAATGAGAAAGCCAAAAAGATTATAATGTTCAGGGACGAATCCCT
ACCAAACGGCCAACCCAACAACGACAACAACAGATGAATGGAGGTTCTGAAATGGTCAAA
TGTTGTACTTATATATGAAGCTGGAGCATTGATTGATGAACTTGGCCCAATGACCCTCCC
TTTAGAGCCACTTACCACATGAAAGACATGAAATTGTGGATGAGAGAAACAAAGCCCAAT
CACCCTCTCTGTCAGTTTCATGCCTTTGTACACTCAGCTTCCTTTCTACTTTCCAAGGGA
AGTTCAAACACACTCTTCCCTCCCTCTGCACAAGATATCACCTCTGTCGTCGTTATTGTG
GATACTGCCGATGCCTGAGTGTGGAGAAGAAATTCCCTCACAAGCTTCGTTTGCTCCTCA
CCCAACCTAGGAACAGTGTGCTTTCCCTGATGGCGGACGACAACAGGATCCTTAAACTTG
AGCAGAAGCTCTTCATTCACCTTCCTAAGATAATCCTGGTCCCCTATGAT
■■Homology search results ■■ -
sp_hit_id A2SR62
Definition sp|A2SR62|APGM_METLZ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Align length 66
Score (bit) 32.7
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915141|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_A04.
(514 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A2SR62|APGM_METLZ 2,3-bisphosphoglycerate-independent phospho... 33 1.0
sp|A4II73|OVCA2_XENTR Ovarian cancer-associated gene 2 protein h... 32 1.3
sp|Q823I7|ISPG_CHLCV 4-hydroxy-3-methylbut-2-en-1-yl diphosphate... 32 1.8
sp|Q8R9D0|MUTS2_THETN MutS2 protein OS=Thermoanaerobacter tengco... 31 3.9
sp|Q9PKY3|ISPG_CHLMU 4-hydroxy-3-methylbut-2-en-1-yl diphosphate... 31 3.9
sp|Q5L669|ISPG_CHLAB 4-hydroxy-3-methylbut-2-en-1-yl diphosphate... 31 3.9
sp|P38970|HAL5_YEAST Serine/threonine-protein kinase HAL5 OS=Sac... 30 8.5
sp|A6ZQG7|HAL5_YEAS7 Serine/threonine-protein kinase HAL5 OS=Sac... 30 8.5
sp|Q254D2|ISPG_CHLFF 4-hydroxy-3-methylbut-2-en-1-yl diphosphate... 30 8.7

>sp|A2SR62|APGM_METLZ 2,3-bisphosphoglycerate-independent
phosphoglycerate mutase OS=Methanocorpusculum labreanum
(strain ATCC 43576 / DSM 4855 / Z) GN=apgM PE=3 SV=1
Length = 406

Score = 32.7 bits (73), Expect = 1.0
Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
Frame = -1

Query: 496 YLRKVNEELLLKFKDP-VVVRHQGKHTVPRLGEEQTKLVREFLLHTQASAVSTITTTEVI 320
YL +V+ LL F P +++ G H+ P +E + +LH + + +T + I
Sbjct: 316 YLEEVDAALLPFFDMPELMIAVCGDHSTPCTIKEHSADPVPLILHGDGTRIDLVTNYDEI 375

Query: 319 SCAEGG 302
SCA GG
Sbjct: 376 SCAAGG 381


>sp|A4II73|OVCA2_XENTR Ovarian cancer-associated gene 2 protein
homolog OS=Xenopus tropicalis GN=ovca2 PE=2 SV=2
Length = 230

Score = 32.3 bits (72), Expect = 1.3
Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
Frame = -1

Query: 514 IIGDQDYL--RKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFL 371
+IG+ D + +++EL+ F++PV++ H G H VP Q K+ EFL
Sbjct: 177 VIGETDRVISAAMSQELVSHFENPVILMHSGGHYVPACA-PQKKVYWEFL 225


>sp|Q823I7|ISPG_CHLCV 4-hydroxy-3-methylbut-2-en-1-yl diphosphate
synthase OS=Chlamydophila caviae GN=ispG PE=3 SV=1
Length = 606

Score = 32.0 bits (71), Expect = 1.8
Identities = 18/46 (39%), Positives = 25/46 (54%)
Frame = -1

Query: 385 VREFLLHTQASAVSTITTTEVISCAEGGKSVFELPLESRKEAECTK 248
VRE T SA + TE ISC G+++F+LP + + E TK
Sbjct: 490 VREIAFSTLQSAGVRLVKTEYISCPGCGRTLFDLPEVTTRIREKTK 535


>sp|Q8R9D0|MUTS2_THETN MutS2 protein OS=Thermoanaerobacter
tengcongensis GN=mutS2 PE=3 SV=1
Length = 790

Score = 30.8 bits (68), Expect = 3.9
Identities = 18/69 (26%), Positives = 39/69 (56%)
Frame = -1

Query: 463 KFKDPVVVRHQGKHTVPRLGEEQTKLVREFLLHTQASAVSTITTTEVISCAEGGKSVFEL 284
+ ++P++ QG++ VP +++ + V + ++H Q+S +T+ E I + + EL
Sbjct: 183 ELQEPIITMRQGRYVVP--VKQEYRNVFKGIIHDQSSTGATL-FIEPIQVVDLNNELREL 239

Query: 283 PLESRKEAE 257
L+ +KE E
Sbjct: 240 ELKEQKEIE 248


>sp|Q9PKY3|ISPG_CHLMU 4-hydroxy-3-methylbut-2-en-1-yl diphosphate
synthase OS=Chlamydia muridarum GN=ispG PE=3 SV=1
Length = 601

Score = 30.8 bits (68), Expect = 3.9
Identities = 19/48 (39%), Positives = 25/48 (52%)
Frame = -1

Query: 391 KLVREFLLHTQASAVSTITTTEVISCAEGGKSVFELPLESRKEAECTK 248
KL R SA TT E ISC G+++F+LP S++ E TK
Sbjct: 482 KLARTLGFSILQSANIRSTTVEYISCPGCGRTLFDLPEVSQRIKERTK 529


>sp|Q5L669|ISPG_CHLAB 4-hydroxy-3-methylbut-2-en-1-yl diphosphate
synthase OS=Chlamydophila abortus GN=ispG PE=3 SV=1
Length = 606

Score = 30.8 bits (68), Expect = 3.9
Identities = 17/46 (36%), Positives = 26/46 (56%)
Frame = -1

Query: 385 VREFLLHTQASAVSTITTTEVISCAEGGKSVFELPLESRKEAECTK 248
VRE T SA + TE ISC G+++F+LP +++ E T+
Sbjct: 490 VREIAFGTLQSAGVRLVKTEYISCPGCGRTLFDLPEVTKRIHERTQ 535


>sp|P38970|HAL5_YEAST Serine/threonine-protein kinase HAL5
OS=Saccharomyces cerevisiae GN=HAL5 PE=1 SV=2
Length = 855

Score = 29.6 bits (65), Expect = 8.5
Identities = 13/37 (35%), Positives = 19/37 (51%)
Frame = -3

Query: 236 TERVIGLCFSHPQFHVFHVVSGSKGRVIGPSSSINAP 126
+E +IG SHP F +++G+ R P NAP
Sbjct: 565 SEFIIGHSLSHPHFEANAMIAGNVSRTTPPKHVFNAP 601


>sp|A6ZQG7|HAL5_YEAS7 Serine/threonine-protein kinase HAL5
OS=Saccharomyces cerevisiae (strain YJM789) GN=HAL5 PE=3
SV=1
Length = 855

Score = 29.6 bits (65), Expect = 8.5
Identities = 13/37 (35%), Positives = 19/37 (51%)
Frame = -3

Query: 236 TERVIGLCFSHPQFHVFHVVSGSKGRVIGPSSSINAP 126
+E +IG SHP F +++G+ R P NAP
Sbjct: 565 SEFIIGHSLSHPHFEANAMIAGNVSRTTPPKHVFNAP 601


>sp|Q254D2|ISPG_CHLFF 4-hydroxy-3-methylbut-2-en-1-yl diphosphate
synthase OS=Chlamydophila felis (strain Fe/C-56) GN=ispG
PE=3 SV=1
Length = 606

Score = 29.6 bits (65), Expect = 8.7
Identities = 15/35 (42%), Positives = 20/35 (57%)
Frame = -1

Query: 385 VREFLLHTQASAVSTITTTEVISCAEGGKSVFELP 281
VRE T SA + TE ISC G+++F+LP
Sbjct: 490 VREIAFGTLQSAGVRLVKTEYISCPGCGRTLFDLP 524


tr_hit_id Q8LIG3
Definition tr|Q8LIG3|Q8LIG3_ORYSJ Os07g0687100 protein OS=Oryza sativa subsp. japonica
Align length 85
Score (bit) 52.4
E-value 1.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915141|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_A04.
(514 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8LIG3|Q8LIG3_ORYSJ Os07g0687100 protein OS=Oryza sativa subs... 52 1e-05
tr|B8B658|B8B658_ORYSI Putative uncharacterized protein OS=Oryza... 49 1e-04
tr|A7PTF9|A7PTF9_VITVI Chromosome chr8 scaffold_29, whole genome... 48 3e-04
tr|Q7XV53|Q7XV53_ORYSJ Os04g0450100 protein OS=Oryza sativa subs... 47 4e-04
tr|Q01JG7|Q01JG7_ORYSA H0818E04.16 protein OS=Oryza sativa GN=H0... 47 4e-04
tr|A2XU19|A2XU19_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|A7NUR0|A7NUR0_VITVI Chromosome chr18 scaffold_1, whole genome... 47 6e-04
tr|A7PEU2|A7PEU2_VITVI Chromosome chr11 scaffold_13, whole genom... 47 7e-04
tr|B6TQZ3|B6TQZ3_MAIZE Putative uncharacterized protein OS=Zea m... 45 0.002
tr|Q9STV6|Q9STV6_ARATH Putative uncharacterized protein AT4g2438... 44 0.004
tr|Q8LC87|Q8LC87_ARATH Putative uncharacterized protein OS=Arabi... 44 0.004
tr|Q8GX45|Q8GX45_ARATH Putative uncharacterized protein At4g2438... 44 0.004
tr|A9PEK0|A9PEK0_POPTR Putative uncharacterized protein OS=Popul... 44 0.004
tr|A5AZ07|A5AZ07_VITVI Putative uncharacterized protein OS=Vitis... 44 0.004
tr|B6UG11|B6UG11_MAIZE Putative uncharacterized protein OS=Zea m... 44 0.005
tr|A9PDU2|A9PDU2_POPTR Putative uncharacterized protein OS=Popul... 42 0.014
tr|Q9FKP9|Q9FKP9_ARATH Similarity to unknown protein OS=Arabidop... 39 0.15
tr|Q0V802|Q0V802_ARATH At5g65400 OS=Arabidopsis thaliana PE=2 SV=1 39 0.15
tr|A8I8I9|A8I8I9_CHLRE Predicted protein OS=Chlamydomonas reinha... 38 0.26
tr|A9RWN1|A9RWN1_PHYPA Predicted protein OS=Physcomitrella paten... 37 0.44
tr|A9TKW1|A9TKW1_PHYPA Predicted protein OS=Physcomitrella paten... 35 1.7
tr|B3S896|B3S896_TRIAD Putative uncharacterized protein OS=Trich... 35 2.2
tr|A0D1W9|A0D1W9_PARTE Chromosome undetermined scaffold_34, whol... 34 3.7

>tr|Q8LIG3|Q8LIG3_ORYSJ Os07g0687100 protein OS=Oryza sativa subsp.
japonica GN=OJ1200_C08.123 PE=2 SV=1
Length = 247

Score = 52.4 bits (124), Expect = 1e-05
Identities = 31/85 (36%), Positives = 47/85 (55%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFLLHTQASAVSTITT 332
IG++D+L+ +EEL F+DPV++RH HTVPRL E K + E+ +S + I
Sbjct: 160 IGEKDWLKVPSEELAAAFEDPVIIRHPQGHTVPRLDEASVKQLSEW----SSSILEDIKN 215

Query: 331 TEVISCAEGGKSVFELPLESRKEAE 257
+ ++ A S+ E P E AE
Sbjct: 216 ADDVAKA----SIVEKPSEGNTVAE 236


>tr|B8B658|B8B658_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_27396 PE=4 SV=1
Length = 247

Score = 48.9 bits (115), Expect = 1e-04
Identities = 22/46 (47%), Positives = 31/46 (67%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREF 374
IG++D+L+ +EEL F+DPV+ RH HTVPRL E K + E+
Sbjct: 160 IGEKDWLKVPSEELAAAFEDPVITRHPQGHTVPRLDEASVKQLSEW 205


>tr|A7PTF9|A7PTF9_VITVI Chromosome chr8 scaffold_29, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023340001
PE=4 SV=1
Length = 261

Score = 47.8 bits (112), Expect = 3e-04
Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 4/58 (6%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVR----EFLLHTQASA 350
IG +D+LR +E+L F +P+++RH HTVPRL E T+ +R E LLH +A
Sbjct: 154 IGAKDWLRLPSEDLATAFDNPLIIRHPQGHTVPRLDEAATEQLRSWTTEILLHQSNNA 211


>tr|Q7XV53|Q7XV53_ORYSJ Os04g0450100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0086B14.2 PE=4 SV=1
Length = 245

Score = 47.4 bits (111), Expect = 4e-04
Identities = 21/63 (33%), Positives = 37/63 (58%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFLLHTQASAVSTITT 332
+GD D+L+ E+L+ + DP ++RH HTVPRL E+ +++ FL + ++
Sbjct: 176 LGDTDFLKTHGEKLIESYVDPFIIRHPKGHTVPRLDEKSLEIMLRFLDKIEKETALEHSS 235

Query: 331 TEV 323
T+V
Sbjct: 236 TDV 238


>tr|Q01JG7|Q01JG7_ORYSA H0818E04.16 protein OS=Oryza sativa
GN=H0818E04.16 PE=4 SV=1
Length = 245

Score = 47.4 bits (111), Expect = 4e-04
Identities = 21/63 (33%), Positives = 37/63 (58%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFLLHTQASAVSTITT 332
+GD D+L+ E+L+ + DP ++RH HTVPRL E+ +++ FL + ++
Sbjct: 176 LGDTDFLKTHGEKLIESYVDPFIIRHPKGHTVPRLDEKSLEIMLRFLDKIEKETALEHSS 235

Query: 331 TEV 323
T+V
Sbjct: 236 TDV 238


>tr|A2XU19|A2XU19_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_16097 PE=4 SV=1
Length = 245

Score = 47.4 bits (111), Expect = 4e-04
Identities = 21/63 (33%), Positives = 37/63 (58%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFLLHTQASAVSTITT 332
+GD D+L+ E+L+ + DP ++RH HTVPRL E+ +++ FL + ++
Sbjct: 176 LGDTDFLKTHGEKLIESYVDPFIIRHPKGHTVPRLDEKSLEIMLRFLDKIEKETALEHSS 235

Query: 331 TEV 323
T+V
Sbjct: 236 TDV 238


>tr|A7NUR0|A7NUR0_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015146001
PE=4 SV=1
Length = 226

Score = 47.0 bits (110), Expect = 6e-04
Identities = 22/51 (43%), Positives = 32/51 (62%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFLLHTQ 359
+G+ D+LR+ ELL F DP+V+ H HTVPRL E+ +++ FL Q
Sbjct: 165 LGETDFLRQYGIELLESFVDPLVIHHPKGHTVPRLDEKSLQIMLGFLERIQ 215


>tr|A7PEU2|A7PEU2_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016789001
PE=4 SV=1
Length = 153

Score = 46.6 bits (109), Expect = 7e-04
Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 4/53 (7%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVR----EFLLH 365
IG +D+LR +E+L F +P+++RH HT+PRL E T+ +R E LLH
Sbjct: 34 IGAKDWLRLPSEDLATAFDNPLIIRHPQGHTIPRLDEAATEQLRSCSTEILLH 86


>tr|B6TQZ3|B6TQZ3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 244

Score = 45.4 bits (106), Expect = 0.002
Identities = 22/71 (30%), Positives = 40/71 (56%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFLLHTQASAVSTITT 332
IG++D+L+ +EEL F +P+++RH HTVPRL + K + E+ + + + +
Sbjct: 160 IGEKDWLKVPSEELASAFDEPLIIRHPQGHTVPRLDDVSVKQLSEW----SSRVLEDLKS 215

Query: 331 TEVISCAEGGK 299
+V + GK
Sbjct: 216 ADVPEALDSGK 226


>tr|Q9STV6|Q9STV6_ARATH Putative uncharacterized protein AT4g24380
OS=Arabidopsis thaliana GN=T22A6.210 PE=2 SV=1
Length = 208

Score = 44.3 bits (103), Expect = 0.004
Identities = 19/47 (40%), Positives = 30/47 (63%)
Frame = -1

Query: 511 IGDQDYLRKVNEELLLKFKDPVVVRHQGKHTVPRLGEEQTKLVREFL 371
+G+ D+L+ +L+ +K+PVVV H HTVPRL E+ + V F+
Sbjct: 139 LGETDFLKPYGTQLIESYKNPVVVHHPKGHTVPRLDEKSLEKVTAFI 185