BP915167
Clone id YMU001_000067_C11
Library
Length 527
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGATGGCTGTGCCACAAGGAGCCGTTTGTGCGCACTATGTGTGCTATTGTGAGGAATCTG
CTTCCCCGGAGCTGGCAGGTCCAGTTCCTGAGCGCTTAAAAGAGCTTCTAGCTGATTCTG
ATGCTGAGATGGCCTAACAGGCTTGATTACATTGTTGTGCCCAAACAGAATCCTCCTCCC
TCCTCCTCTGCCTCCTCTTCCACCCACTTTCAAACTGTCAAAAAGTGTGGGATATATCTA
CAGATGCCCCCTCGAGTTTGTATATAACCGTTCCGGCAGGCAATTCGTTTGTATTCTCTG
TGCGAAACCGCAATTTCATTGTAACAATAGCATTGATCGGTCATGCAATTTTGTCATGGA
GTTTCGGCAGAGTTCTGTGTAACATGGAAGCACTCTTCCTTGACTCCTTGTATCCCACTC
CTAGCGAGAAGCCAAGAGGAATTTGTACATTTTTGGATTCTTTATACCTTGTGCGCGCTT
AGGTCTGAGCAATATCTTGATTGTCTATGGGAGTTGTAATTATATAG
■■Homology search results ■■ -
sp_hit_id Q8N6U8
Definition sp|Q8N6U8|GP161_HUMAN Probable G-protein coupled receptor 161 OS=Homo sapiens
Align length 43
Score (bit) 32.7
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915167|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_C11.
(527 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8N6U8|GP161_HUMAN Probable G-protein coupled receptor 161 OS... 33 1.1
sp|A1RV37|TF2B_PYRIL Transcription initiation factor IIB OS=Pyro... 31 3.2
sp|P16793|UL52_HCMVA Probable major envelope glycoprotein UL52 O... 31 4.1
sp|A4WMA6|TF2B_PYRAR Transcription initiation factor IIB OS=Pyro... 31 4.1
sp|Q80WK7|S29A3_RAT Equilibrative nucleoside transporter 3 OS=Ra... 31 4.1
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-contai... 31 4.1
sp|Q25255|PE44_LUCCU Peritrophin-44 OS=Lucilia cuprina PE=1 SV=1 30 5.4
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-contai... 30 5.4
sp|Q08054|CSI2_YEAST Chitin synthase 3 complex protein CSI2 OS=S... 30 5.4
sp|O14307|TRM61_SCHPO tRNA (adenine-N(1)-)-methyltransferase cat... 30 9.2
sp|O76050|NEUL1_HUMAN Neuralized-like protein 1 OS=Homo sapiens ... 30 9.2
sp|Q4PHV3|IPI3_USTMA Pre-rRNA-processing protein IPI3 OS=Ustilag... 30 9.2

>sp|Q8N6U8|GP161_HUMAN Probable G-protein coupled receptor 161
OS=Homo sapiens GN=GPR161 PE=2 SV=1
Length = 529

Score = 32.7 bits (73), Expect = 1.1
Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 5/43 (11%)
Frame = +3

Query: 282 NSFVFSVRNRNFIVTIALIGHAILS-----WSFGRVLCNMEAL 395
N FVFS+ NF++++ ++ + S W FG V CN AL
Sbjct: 63 NKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSAL 105


>sp|A1RV37|TF2B_PYRIL Transcription initiation factor IIB
OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189)
GN=tfb PE=3 SV=1
Length = 333

Score = 31.2 bits (69), Expect = 3.2
Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 4/33 (12%)
Frame = +2

Query: 215 LSKSVGYIYRCPL----EFVYNRSGRQFVCILC 301
L G +YRCP+ FVYN + VCI+C
Sbjct: 27 LVTDTGEVYRCPICGNDRFVYNYERGEIVCIVC 59


>sp|P16793|UL52_HCMVA Probable major envelope glycoprotein UL52
OS=Human cytomegalovirus (strain AD169) GN=UL52 PE=3
SV=1
Length = 668

Score = 30.8 bits (68), Expect = 4.1
Identities = 12/29 (41%), Positives = 18/29 (62%)
Frame = +2

Query: 215 LSKSVGYIYRCPLEFVYNRSGRQFVCILC 301
L K+VG IY CP+ + ++ VC+LC
Sbjct: 434 LKKNVGPIYLCPVPAFFTKNQTSTVCLLC 462


>sp|A4WMA6|TF2B_PYRAR Transcription initiation factor IIB
OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM
11321) GN=tfb PE=3 SV=1
Length = 333

Score = 30.8 bits (68), Expect = 4.1
Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 4/28 (14%)
Frame = +2

Query: 230 GYIYRCPL----EFVYNRSGRQFVCILC 301
G IYRCP+ FVYN + VCI+C
Sbjct: 32 GEIYRCPICGNDRFVYNYERGEVVCIVC 59


>sp|Q80WK7|S29A3_RAT Equilibrative nucleoside transporter 3
OS=Rattus norvegicus GN=Slc29a3 PE=2 SV=1
Length = 475

Score = 30.8 bits (68), Expect = 4.1
Identities = 17/48 (35%), Positives = 27/48 (56%)
Frame = -3

Query: 171 ILFGHNNVIKPVRPSQHQNQLEALLSAQELDLPAPGKQIPHNSTHSAH 28
I + +N + V ++H+ EALL + LD PAPG Q P + + A+
Sbjct: 8 IAYHSSNAVYRVPSNRHEADQEALLG-KPLDYPAPGLQRPEDRFNGAY 54


>sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell
antigen-like-containing domain protein 2 OS=Bos taurus
GN=LIMS2 PE=2 SV=2
Length = 341

Score = 30.8 bits (68), Expect = 4.1
Identities = 14/31 (45%), Positives = 17/31 (54%)
Frame = -1

Query: 95 ALRNWTCQLRGSRFLTIAHIVRTNGSLWHSH 3
AL N CQ +RF IV +NG L+H H
Sbjct: 9 ALANAVCQRCQARFAPAERIVNSNGELYHEH 39


>sp|Q25255|PE44_LUCCU Peritrophin-44 OS=Lucilia cuprina PE=1 SV=1
Length = 356

Score = 30.4 bits (67), Expect = 5.4
Identities = 23/77 (29%), Positives = 30/77 (38%), Gaps = 10/77 (12%)
Frame = -1

Query: 413 IQGVKEECFHVTQNSAETP*QNCMTDQCYCYNEIAVSHR-------EYKRIACRNGYIQ- 258
I K C H T NS NC CYC N+ A + K+I C +
Sbjct: 84 ISDSKNACLHATDNSFVADPTNC-NGYCYCSNKTATCTTCPEFQLFDSKQIKCVYALEKP 142

Query: 257 --TRGGICRYIPHFLTV 213
T ICR +P+ + V
Sbjct: 143 ECTADSICRLVPNAVYV 159


>sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell
antigen-like-containing domain protein 2 OS=Homo sapiens
GN=LIMS2 PE=1 SV=1
Length = 341

Score = 30.4 bits (67), Expect = 5.4
Identities = 14/31 (45%), Positives = 17/31 (54%)
Frame = -1

Query: 95 ALRNWTCQLRGSRFLTIAHIVRTNGSLWHSH 3
AL N CQ +RF IV +NG L+H H
Sbjct: 9 ALANAVCQRCQARFSPAERIVNSNGELYHEH 39


>sp|Q08054|CSI2_YEAST Chitin synthase 3 complex protein CSI2
OS=Saccharomyces cerevisiae GN=CSI2 PE=1 SV=1
Length = 341

Score = 30.4 bits (67), Expect = 5.4
Identities = 15/35 (42%), Positives = 20/35 (57%)
Frame = +3

Query: 237 STDAPSSLYITVPAGNSFVFSVRNRNFIVTIALIG 341
S+ PSS+YI V GN F++ + N V IA G
Sbjct: 106 SSITPSSVYIPVTDGNKFLYQAHHPNGTVFIAFAG 140


>sp|O14307|TRM61_SCHPO tRNA (adenine-N(1)-)-methyltransferase
catalytic subunit trm61 OS=Schizosaccharomyces pombe
GN=cpd1 PE=2 SV=1
Length = 364

Score = 29.6 bits (65), Expect = 9.2
Identities = 14/29 (48%), Positives = 17/29 (58%)
Frame = -3

Query: 108 EALLSAQELDLPAPGKQIPHNSTHSAHKR 22
E + A LDLPAP + IPH S H H +
Sbjct: 177 EVKVDAIFLDLPAPWEAIPHLSNHVNHDK 205


tr_hit_id B8LR34
Definition tr|B8LR34|B8LR34_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 37
Score (bit) 40.4
E-value 0.055
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915167|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_C11.
(527 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LR34|B8LR34_PICSI Putative uncharacterized protein OS=Picea... 40 0.055
tr|B6SWC0|B6SWC0_MAIZE Putative uncharacterized protein OS=Zea m... 36 1.4
tr|Q90X46|Q90X46_DANRE Novel protein similar to human G-protein ... 34 5.2
tr|A4IGB3|A4IGB3_DANRE G protein-coupled receptor 161 OS=Danio r... 34 5.2
tr|Q8H3D6|Q8H3D6_ORYSJ Putative uncharacterized protein P0018C07... 33 6.7
tr|Q0D408|Q0D408_ORYSJ Os07g0656100 protein OS=Oryza sativa subs... 33 6.7
tr|B8B5E2|B8B5E2_ORYSI Putative uncharacterized protein OS=Oryza... 33 6.7
tr|B8A2P1|B8A2P1_MAIZE Putative uncharacterized protein OS=Zea m... 33 6.7
tr|B6U4P6|B6U4P6_MAIZE Putative uncharacterized protein OS=Zea m... 33 6.7
tr|A3BMZ4|A3BMZ4_ORYSJ Putative uncharacterized protein OS=Oryza... 33 6.7
tr|A2QH68|A2QH68_ASPNC Similarity to hypothetical protein SCF91.... 33 8.8

>tr|B8LR34|B8LR34_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 482

Score = 40.4 bits (93), Expect = 0.055
Identities = 17/37 (45%), Positives = 23/37 (62%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKELLA 113
MAVPQ VCA+YVC+ E + E VP+ +K+ A
Sbjct: 442 MAVPQACVCAYYVCFAENPENREFDNTVPDSIKDFEA 478


>tr|B6SWC0|B6SWC0_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 499

Score = 35.8 bits (81), Expect = 1.4
Identities = 16/37 (43%), Positives = 23/37 (62%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKELLA 113
+A PQ V A++V Y E +P+L +PE L+EL A
Sbjct: 443 IAWPQACVAAYHVAYAENPQNPQLGTLIPEHLRELQA 479


>tr|Q90X46|Q90X46_DANRE Novel protein similar to human G-protein
coupled receptor RE2 OS=Danio rerio GN=gpr161 PE=2 SV=2
Length = 526

Score = 33.9 bits (76), Expect = 5.2
Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 5/50 (10%)
Frame = +3

Query: 261 YITVPAGNSFVFSVRNRNFIVTIALIGHAILS-----WSFGRVLCNMEAL 395
Y+ P+ N FVFS+ + N ++++ ++ + S W FG V CN AL
Sbjct: 53 YLLTPS-NKFVFSLTSSNLLLSVLMLPFVVASSVRRDWMFGVVWCNFTAL 101


>tr|A4IGB3|A4IGB3_DANRE G protein-coupled receptor 161 OS=Danio
rerio GN=gpr161 PE=2 SV=1
Length = 527

Score = 33.9 bits (76), Expect = 5.2
Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 5/50 (10%)
Frame = +3

Query: 261 YITVPAGNSFVFSVRNRNFIVTIALIGHAILS-----WSFGRVLCNMEAL 395
Y+ P+ N FVFS+ + N ++++ ++ + S W FG V CN AL
Sbjct: 53 YLLTPS-NKFVFSLTSSNLLLSVLMLPFVVASTVRRDWMFGVVWCNFTAL 101


>tr|Q8H3D6|Q8H3D6_ORYSJ Putative uncharacterized protein
P0018C07.126 OS=Oryza sativa subsp. japonica
GN=P0018C07.126 PE=4 SV=1
Length = 567

Score = 33.5 bits (75), Expect = 6.7
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKELLADSD 122
MA+PQ V +YVC+ E S +PERL ++ +D
Sbjct: 512 MALPQACVGCYYVCFAENPTSRLFDPTIPERLHKMQEGAD 551


>tr|Q0D408|Q0D408_ORYSJ Os07g0656100 protein OS=Oryza sativa subsp.
japonica GN=Os07g0656100 PE=4 SV=1
Length = 647

Score = 33.5 bits (75), Expect = 6.7
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKELLADSD 122
MA+PQ V +YVC+ E S +PERL ++ +D
Sbjct: 592 MALPQACVGCYYVCFAENPTSRLFDPTIPERLHKMQEGAD 631


>tr|B8B5E2|B8B5E2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_27162 PE=4 SV=1
Length = 505

Score = 33.5 bits (75), Expect = 6.7
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKELLADSD 122
MA+PQ V +YVC+ E S +PERL ++ +D
Sbjct: 450 MALPQACVGCYYVCFAENPTSRLFDPTIPERLHKMQEGAD 489


>tr|B8A2P1|B8A2P1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 452

Score = 33.5 bits (75), Expect = 6.7
Identities = 14/35 (40%), Positives = 20/35 (57%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKEL 107
MA+PQ V +YVCY E S G +P +L ++
Sbjct: 397 MALPQACVGCYYVCYAENPTSRLFDGNIPNQLSKM 431


>tr|B6U4P6|B6U4P6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 537

Score = 33.5 bits (75), Expect = 6.7
Identities = 14/35 (40%), Positives = 20/35 (57%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKEL 107
MA+PQ V +YVCY E S G +P +L ++
Sbjct: 482 MALPQACVGCYYVCYAENPTSRLFDGNIPNQLSKM 516


>tr|A3BMZ4|A3BMZ4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_024416 PE=4 SV=1
Length = 470

Score = 33.5 bits (75), Expect = 6.7
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +3

Query: 3 MAVPQGAVCAHYVCYCEESASPELAGPVPERLKELLADSD 122
MA+PQ V +YVC+ E S +PERL ++ +D
Sbjct: 415 MALPQACVGCYYVCFAENPTSRLFDPTIPERLHKMQEGAD 454