BP915168
Clone id YMU001_000067_C12
Library
Length 576
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGCAGTGCCATATGTCATGGGGCTGTTCAGTTGCACGTGAAGAAGGACATCATTCTATCA
AGGATTGCTAAGAGGACGTATGGTATTTTGTACTGCAGGGGCTTGAGAGTGGATGATCCT
TTTGATCTGCGTTATGTTGATGATGATGGAGATTTTTACTGCCAAGATTGCATCGATGTT
TTCGTTACAACAGGAGAGCGGGTGCAGCTTGATTTATCAGTCAAAAGAATATATATCCCT
ACAGTACATGGCCAACAAGTAATGGAGATTGAGTTGTGGAGTTCCACAAGTAAGCATCCC
AAATACGCGAGAGATGTGGATGTGATCAAGGAAGGAAGCTTTGTCGTCGACATTTCAGAA
GGGATGGAGCTGGACAAGGATCGACAGGTGGAGGTTACCATGGCATTTGGGGCTTCTCTT
ATTGAAGTGAGTGCAGATTGTCTAAATTTCGGTAAGGCTGGCATGAAAAGGGGCCTTTCA
GTGGGGTTCCACAAGGCTTGATGGAATGCCACCAGAGGGACGATCTCTGAATGTGGGAAT
GTGTCATGCGTNTATGTCTCGTTGATATGCAGAGAC
■■Homology search results ■■ -
sp_hit_id Q8K0U4
Definition sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus
Align length 151
Score (bit) 54.7
E-value 3.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915168|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_C12.
(576 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus muscu... 55 3e-07
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapi... 55 3e-07
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapi... 44 4e-04
sp|Q9CZJ2|HS12B_MOUSE Heat shock 70 kDa protein 12B OS=Mus muscu... 44 6e-04
sp|O83981|CNPD_TREPA 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 35 0.21
sp|Q06668|OMS1_YEAST Methyltransferase OMS1, mitochondrial OS=Sa... 35 0.35
sp|Q998L9|HBSAG_HBVC9 Large envelope protein OS=Hepatitis B viru... 32 1.7
sp|Q6ZVD8|PHLPL_HUMAN PH domain leucine-rich repeat protein phos... 31 3.9
sp|O75443|TECTA_HUMAN Alpha-tectorin OS=Homo sapiens GN=TECTA PE... 31 3.9
sp|Q4JIM5|ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculu... 31 5.1
sp|Q4VZL0|YCF1_CUCSA Putative membrane protein ycf1 OS=Cucumis s... 30 6.6
sp|Q5RF01|LRC32_PONAB Leucine-rich repeat-containing protein 32 ... 30 6.6
sp|O46248|HUNB_DROMM Protein hunchback (Fragments) OS=Drosophila... 30 6.6
sp|Q5R0L8|MRAZ_IDILO Protein mraZ OS=Idiomarina loihiensis GN=mr... 30 6.7
sp|Q5UR33|YR555_MIMIV Uncharacterized protein R555 OS=Acanthamoe... 30 8.6
sp|P12911|HBSAG_HBVCP Large envelope protein OS=Chimpanzee hepat... 30 8.6
sp|P31873|HBSAG_HBVA1 Large envelope protein OS=Hepatitis B viru... 30 8.6
sp|O08523|TECTA_MOUSE Alpha-tectorin OS=Mus musculus GN=Tecta PE... 30 8.7
sp|A3DJL6|SYP_CLOTH Prolyl-tRNA synthetase OS=Clostridium thermo... 30 8.7
sp|Q8L5K3|RLC1_CITLI (R)-limonene synthase 1 OS=Citrus limon PE=... 30 8.7

>sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus
GN=Hspa12a PE=1 SV=1
Length = 675

Score = 54.7 bits (130), Expect = 3e-07
Identities = 43/151 (28%), Positives = 69/151 (45%), Gaps = 6/151 (3%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGI----LYCRGLRVDDPFDLRYVDDDGDFYCQD 168
G I GAV + +I R + TYG+ Y G + ++ DG +C D
Sbjct: 511 GLTILKGAVLFGLDPAVIKVRRSPLTYGVGVLNRYVEGKHPPEKLLVK----DGTRWCTD 566

Query: 169 CIDVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVV 348
D F++ + V L VKR Y P Q V+ I ++SS + + D V K G+ +
Sbjct: 567 VFDKFISADQSVALGELVKRSYTPAKPSQLVIIINIYSSEHDNVSFITDPGVKKCGTLRL 626

Query: 349 DI--SEGMELDKDRQVEVTMAFGASLIEVSA 435
D+ S G + R+++ M FG + I+ +A
Sbjct: 627 DLTGSGGTAVPARREIQTIMQFGDTEIKATA 657


>sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens
GN=HSPA12A PE=1 SV=2
Length = 675

Score = 54.7 bits (130), Expect = 3e-07
Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 6/151 (3%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGI----LYCRGLRVDDPFDLRYVDDDGDFYCQD 168
G I GAV + +I R + TYG+ Y G + ++ DG +C D
Sbjct: 511 GLTILKGAVLFGLDPAVIKVRRSPLTYGVGVLNRYVEGKHPPEKLLVK----DGTRWCTD 566

Query: 169 CIDVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVV 348
D F++ + V L VKR Y P Q V+ I ++SS + + D V K G+ +
Sbjct: 567 VFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRL 626

Query: 349 DI--SEGMELDKDRQVEVTMAFGASLIEVSA 435
D+ + G + R+++ M FG + I+ +A
Sbjct: 627 DLTGTSGTAVPARREIQTLMQFGDTEIKATA 657


>sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens
GN=HSPA12B PE=1 SV=2
Length = 686

Score = 44.3 bits (103), Expect = 4e-04
Identities = 40/157 (25%), Positives = 69/157 (43%), Gaps = 12/157 (7%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGI----LYCRGLRVDDPFDLRYVDDDGDFYCQD 168
G I GAV ++ R + TYG+ + G + +R DG +C D
Sbjct: 517 GLTILKGAVLFGQAPGVVRVRRSPLTYGVGVLNRFVPGRHPPEKLLVR----DGRRWCTD 572

Query: 169 CIDVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVV 348
+ FV + V L V+R Y P GQ+ + I L+ ++ ++ D V K G+ +
Sbjct: 573 VFERFVAAEQSVALGEEVRRSYCPARPGQRRVLINLYCCAAEDARFITDPGVRKCGALSL 632

Query: 349 DISEGMELDKD--------RQVEVTMAFGASLIEVSA 435
++ E + +D R++ M FG + I+V+A
Sbjct: 633 EL-EPADCGQDTAGAPPGRREIRAAMQFGDTEIKVTA 668


>sp|Q9CZJ2|HS12B_MOUSE Heat shock 70 kDa protein 12B OS=Mus musculus
GN=Hspa12b PE=1 SV=1
Length = 685

Score = 43.9 bits (102), Expect = 6e-04
Identities = 38/151 (25%), Positives = 65/151 (43%), Gaps = 6/151 (3%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLRVDDPFDLRYVDDDGDFYCQDCIDV 180
G I GAV ++ R + TYG+ + + DG +C D +
Sbjct: 517 GLTILKGAVLFGQAPGVVRVRRSPLTYGVGVLNRFVPGHHPPEKLLVRDGRRWCTDVFER 576

Query: 181 FVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDIS- 357
FV + V L V+R Y P GQ+ + I L+ ++ ++ D V K G+ +++
Sbjct: 577 FVAAEQSVALGEEVRRSYCPARPGQRRVLINLYCCAAEDARFITDPGVRKCGALSLELEP 636

Query: 358 EGMELD-----KDRQVEVTMAFGASLIEVSA 435
EG + R++ M FG + I+V+A
Sbjct: 637 EGCPENTGTSPSRREIRAAMQFGDTEIKVTA 667


>sp|O83981|CNPD_TREPA 2',3'-cyclic-nucleotide 2'-phosphodiesterase
OS=Treponema pallidum GN=TP_1018 PE=3 SV=1
Length = 504

Score = 35.4 bits (80), Expect = 0.21
Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 16/94 (17%)
Frame = +1

Query: 193 GERVQLDLSVK-----------RIYIPTVHGQQVM----EIELWSSTSKHPKYARDVDVI 327
GE+V DL + R+Y T +GQ V+ E+ L +S + DV +
Sbjct: 287 GEKVLFDLGIHDMCPEGVRALGRLYFRTSYGQNVLYHSKEVALLASMLAS-EIGADVAIA 345

Query: 328 KEGSFVVDISEGMELDKDR-QVEVTMAFGASLIE 426
K G+ + DI +G+E D DR E+ M + E
Sbjct: 346 KRGALLHDIGKGVETDSDRNHAEIGMEMARKMNE 379


>sp|Q06668|OMS1_YEAST Methyltransferase OMS1, mitochondrial
OS=Saccharomyces cerevisiae GN=OMS1 PE=1 SV=1
Length = 471

Score = 34.7 bits (78), Expect = 0.35
Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 10/110 (9%)
Frame = +1

Query: 157 YCQ-DCIDVFVTTGERVQ-LDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIK 330
+CQ D ++V TG ++ LD+S + +MEI K PKY + V+
Sbjct: 240 HCQGDVLEVSCGTGRNIKYLDMSRINSITFLDSSENMMEITHKKFREKFPKYKKVAFVVG 299

Query: 331 EGSFVVDISE----GMELDKDRQVE---VTMAFGASLIEVSADCL-NFGK 456
+ +VD++E +E +K+ QV+ + AFG E L NFGK
Sbjct: 300 KAENLVDLAEKGKPSLENEKENQVKYDTIVEAFGLCSHEDPVKALNNFGK 349


>sp|Q998L9|HBSAG_HBVC9 Large envelope protein OS=Hepatitis B virus
genotype C subtype ayw (isolate Australia/AustRC/1992)
GN=S PE=1 SV=2
Length = 400

Score = 32.3 bits (72), Expect = 1.7
Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
Frame = -2

Query: 545 DTFPHSEIVPLVAFHQALWNPTERPLFMPALPKFRQSALTSIREAPNAMVTSTCRSLSSS 366
DT P + AFHQAL +P R L+ PA S+ ++ PN + S
Sbjct: 114 DTHPQAMQWNSTAFHQALQDPRVRGLYFPA----GGSSSGTVNPVPNTV---------SH 160

Query: 365 IPSEMSTTKLP-SLITSTSLAYLGCLLV 285
I S + T P S + ST+ +LG LLV
Sbjct: 161 ISSIFTKTGDPASNMESTTSGFLGPLLV 188


>sp|Q6ZVD8|PHLPL_HUMAN PH domain leucine-rich repeat protein
phosphatase-like OS=Homo sapiens GN=PHLPPL PE=1 SV=3
Length = 1323

Score = 31.2 bits (69), Expect = 3.9
Identities = 14/42 (33%), Positives = 27/42 (64%)
Frame = -2

Query: 437 SALTSIREAPNAMVTSTCRSLSSSIPSEMSTTKLPSLITSTS 312
++ T+I++AP S+ ++S SEMST+++ S + ST+
Sbjct: 1056 ASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTA 1097


>sp|O75443|TECTA_HUMAN Alpha-tectorin OS=Homo sapiens GN=TECTA PE=1
SV=1
Length = 2155

Score = 31.2 bits (69), Expect = 3.9
Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 6/72 (8%)
Frame = +1

Query: 151 DFYCQDCIDVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTS-KHPKYARDV--- 318
+F C +D+ ++ V+ LSV + +PT G + ++ L+ + S KHP +V
Sbjct: 1895 EFSCAYELDIKISLDSVVKPMLSVINLTVPTQEGSFITKMALYKNASYKHPYRQGEVVLT 1954

Query: 319 --DVIKEGSFVV 348
DV+ G FVV
Sbjct: 1955 TRDVLYVGVFVV 1966


>sp|Q4JIM5|ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus
GN=Abl2 PE=1 SV=1
Length = 1182

Score = 30.8 bits (68), Expect = 5.1
Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 2/65 (3%)
Frame = +3

Query: 228 NIYPYSTWPTSNGD*VVEFHK*ASQIRERC--GCDQGRKLCRRHFRRDGAGQGSTGGGYH 401
N P ++ ++G V + + + +C G R LC G G G+ GGG+
Sbjct: 689 NFSPVASLQNADGFSVAPSQQEPNLVPAKCYGGSFAQRNLCADDDSGGGGGSGTAGGGWS 748

Query: 402 GIWGF 416
GI GF
Sbjct: 749 GITGF 753


tr_hit_id A9RFU7
Definition tr|A9RFU7|A9RFU7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 155
Score (bit) 116.0
E-value 1.0e-24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915168|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_C12.
(576 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RFU7|A9RFU7_PHYPA Predicted protein OS=Physcomitrella paten... 116 1e-24
tr|A9S4L7|A9S4L7_PHYPA Predicted protein OS=Physcomitrella paten... 110 7e-23
tr|A9RME9|A9RME9_PHYPA Predicted protein OS=Physcomitrella paten... 99 2e-19
tr|A9S461|A9S461_PHYPA Predicted protein OS=Physcomitrella paten... 94 7e-18
tr|A9SRM9|A9SRM9_PHYPA Predicted protein OS=Physcomitrella paten... 92 3e-17
tr|A9U470|A9U470_PHYPA Predicted protein OS=Physcomitrella paten... 91 4e-17
tr|A9SRN5|A9SRN5_PHYPA Predicted protein OS=Physcomitrella paten... 89 1e-16
tr|A9SZI2|A9SZI2_PHYPA Predicted protein OS=Physcomitrella paten... 89 2e-16
tr|A9RPI8|A9RPI8_PHYPA Predicted protein OS=Physcomitrella paten... 89 2e-16
tr|A9SZV1|A9SZV1_PHYPA Predicted protein OS=Physcomitrella paten... 82 2e-14
tr|A9S3Q3|A9S3Q3_PHYPA Predicted protein OS=Physcomitrella paten... 81 5e-14
tr|A0YV32|A0YV32_9CYAN Putative chaperone protein OS=Lyngbya sp.... 75 3e-12
tr|B6P4N1|B6P4N1_BRAFL Putative uncharacterized protein OS=Branc... 64 5e-09
tr|A0BL94|A0BL94_PARTE Chromosome undetermined scaffold_113, who... 63 1e-08
tr|A0BLS3|A0BLS3_PARTE Chromosome undetermined scaffold_115, who... 62 3e-08
tr|Q23IA0|Q23IA0_TETTH Putative uncharacterized protein OS=Tetra... 61 5e-08
tr|A0E153|A0E153_PARTE Chromosome undetermined scaffold_72, whol... 61 5e-08
tr|A0DKN9|A0DKN9_PARTE Chromosome undetermined scaffold_54, whol... 61 5e-08
tr|B6LAP2|B6LAP2_BRAFL Putative uncharacterized protein OS=Branc... 58 4e-07
tr|Q1MT77|Q1MT77_DANRE Novel protein similar to vertebrate heat ... 57 6e-07
tr|B6P4N0|B6P4N0_BRAFL Putative uncharacterized protein (Fragmen... 57 6e-07
tr|Q5RJ08|Q5RJ08_DANRE Novel protein similar to vertebrate heat ... 57 1e-06
tr|Q0R4G9|Q0R4G9_DANRE HSPA12B (Heat shock protein 12B) OS=Danio... 56 1e-06
tr|B6P4M3|B6P4M3_BRAFL Putative uncharacterized protein OS=Branc... 56 2e-06
tr|B6P086|B6P086_BRAFL Putative uncharacterized protein OS=Branc... 55 2e-06
tr|B6PF39|B6PF39_BRAFL Putative uncharacterized protein (Fragmen... 55 3e-06
tr|B7Z2F7|B7Z2F7_HUMAN cDNA FLJ54655, highly similar to Heat sho... 55 3e-06
tr|B6P084|B6P084_BRAFL Putative uncharacterized protein OS=Branc... 55 4e-06
tr|B7Z2M8|B7Z2M8_HUMAN cDNA FLJ54654, highly similar to Heat sho... 55 4e-06
tr|B7QFU1|B7QFU1_IXOSC Heat shock protein HSP70-12A, putative (F... 54 8e-06

>tr|A9RFU7|A9RFU7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_65569 PE=4 SV=1
Length = 828

Score = 116 bits (290), Expect = 1e-24
Identities = 60/155 (38%), Positives = 93/155 (60%), Gaps = 1/155 (0%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLRVD-DPFDLRYVDDDGDFYCQDCID 177
GS IC GAV L + +++++RI++ TYG+ R DP + ++ DG C++
Sbjct: 662 GSTICQGAVALAFRPEVVVNRISRVTYGVACTRNFENGIDPPEFG-IEVDGALRCENRFS 720

Query: 178 VFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDIS 357
VFV G V+ +++Y P HGQ M +L+SST + P+Y V+KEG+ +DIS
Sbjct: 721 VFVKKGTSVRAQQPFRKVYRPVFHGQTKMTFDLYSSTEEEPRYTVGDTVMKEGTVEIDIS 780

Query: 358 EGMELDKDRQVEVTMAFGASLIEVSADCLNFGKAG 462
G+EL +DRQVE+++ FG + IEV A+ +NF G
Sbjct: 781 SGLELGRDRQVELSLFFGRTSIEVKAEAINFANFG 815


>tr|A9S4L7|A9S4L7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_162811 PE=4 SV=1
Length = 605

Score = 110 bits (274), Expect = 7e-23
Identities = 63/163 (38%), Positives = 94/163 (57%), Gaps = 2/163 (1%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGI--LYCRGLRVDDPFDLRYVDDDGDFYCQDCI 174
GSA+C GAV L + D I SR+ KRTYG Y VD P ++ VD G C+
Sbjct: 424 GSAVCQGAVALALNPDTIESRVCKRTYGFSCTYKFERGVDPPEYMKVVD--GVEKCRRRF 481

Query: 175 DVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDI 354
+FV G++V++D + RI P GQ+ + +L+SS P+YA V KEG V+DI
Sbjct: 482 QIFVRKGDKVRVDSCISRIQRPVTRGQKSIRFQLFSSDEIEPRYALGHSVKKEGEIVIDI 541

Query: 355 SEGMELDKDRQVEVTMAFGASLIEVSADCLNFGKAGMKRGLSV 483
S M+ DK R+V++++ FG S +E+ A+ +NF G ++ L +
Sbjct: 542 SRDMQKDKGREVKLSLFFGRSSLEIKAEAVNFMMEGPQQHLEL 584


>tr|A9RME9|A9RME9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_159966 PE=4 SV=1
Length = 1274

Score = 99.0 bits (245), Expect = 2e-19
Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
Frame = +1

Query: 4 SAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLR--VDDPFDLRYVDDDGDFYCQDCID 177
SA+ GAV L I+SR++++TYG R VD P L +D G C +
Sbjct: 415 SAVSLGAVALAFNPGTIVSRVSRKTYGFHCLRNFEKGVDPPEYLELID--GVSKCYNRFS 472

Query: 178 VFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDIS 357
V+V G+ V +D + + + P + GQQ ++++L+SS +P+Y + KEG +DIS
Sbjct: 473 VYVRKGDIVYVDDCISKTFFPGMRGQQKIQLQLFSSDEINPRYTVGETIKKEGEIEIDIS 532

Query: 358 EGMELDKDRQVEVTMAFGASLIEVSADCLNFGKAG 462
M+LDK R+V+V++ FG S IE+ A+ +NF +G
Sbjct: 533 SDMKLDKKREVKVSLFFGRSSIEIKAEAMNFISSG 567



Score = 87.4 bits (215), Expect = 5e-16
Identities = 57/154 (37%), Positives = 88/154 (57%), Gaps = 5/154 (3%)
Frame = +1

Query: 4 SAICHGAVQLHVKKDII-LSRIAKRTYGI----LYCRGLRVDDPFDLRYVDDDGDFYCQD 168
SA+C GAV + + + +S+ ++TYG + RG+ DP D ++ +G C +
Sbjct: 1106 SAVCQGAVAMVLNRGSAGMSKTCRKTYGFKGMKFFERGV---DP-DEYLLEINGVDKCAN 1161

Query: 169 CIDVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVV 348
VFV GE V +D S+ +I +PT GQ+ M++EL SS P+Y V EG +
Sbjct: 1162 HFQVFVKKGETVTVDSSISKICMPTQSGQKKMKVELVSSDKLDPRYTIGETVRLEGEIEL 1221

Query: 349 DISEGMELDKDRQVEVTMAFGASLIEVSADCLNF 450
DISE M+LD+ R V++T+ F S +EV A+ +NF
Sbjct: 1222 DISEDMKLDQHRAVKLTVYFRKSSLEVVAEAVNF 1255


>tr|A9S461|A9S461_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_162829 PE=4 SV=1
Length = 1065

Score = 93.6 bits (231), Expect = 7e-18
Identities = 51/147 (34%), Positives = 83/147 (56%), Gaps = 1/147 (0%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGI-LYCRGLRVDDPFDLRYVDDDGDFYCQDCID 177
GSAI GAV L + D +++R+ K+TYG + R R DP + V DDG +C++ D
Sbjct: 790 GSAIIQGAVALALNPDAVVARVLKKTYGTSVTLRFQRGVDPEEFLKVGDDGMEWCRNRFD 849

Query: 178 VFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDIS 357
FV G R++++ V + Y+P GQ M +L+SS P+Y + DV++EG F +D+
Sbjct: 850 PFVKKGNRIEVNKFVSKEYVPHSDGQAQMMFDLYSSDLLEPRYTQGPDVVREGGFAIDLP 909

Query: 358 EGMELDKDRQVEVTMAFGASLIEVSAD 438
+ + E T+ FG + +E+ A+
Sbjct: 910 TNYRVTEMPIFECTIYFGRTSLELRAE 936


>tr|A9SRM9|A9SRM9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_233870 PE=4 SV=1
Length = 937

Score = 91.7 bits (226), Expect = 3e-17
Identities = 54/152 (35%), Positives = 87/152 (57%), Gaps = 2/152 (1%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLR--VDDPFDLRYVDDDGDFYCQDCI 174
GSAIC GAV L + D + SRI K+TYGI + VD P + D G C++
Sbjct: 582 GSAICQGAVALALNPDTVDSRICKKTYGIHAMDSFQEGVDPPEYMEIYD--GVPKCKNRF 639

Query: 175 DVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDI 354
+V+V+ G+ V+ + + R + P +GQ+ + +EL+SS +P+Y EGS +DI
Sbjct: 640 EVYVSKGDSVKENEPITRSFKPVRYGQKAITLELYSSDMTNPRYIVGDSACMEGSITIDI 699

Query: 355 SEGMELDKDRQVEVTMAFGASLIEVSADCLNF 450
S+ M+L +R + V++ FG S ++ A+ +NF
Sbjct: 700 SKDMKLQTERLLNVSLFFGKSCLDFIAEHVNF 731


>tr|A9U470|A9U470_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_101722 PE=4 SV=1
Length = 581

Score = 91.3 bits (225), Expect = 4e-17
Identities = 60/153 (39%), Positives = 80/153 (52%), Gaps = 3/153 (1%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLRVD-DPFDL-RYVDDDGDFYCQDCI 174
G AIC GAV + IL R+A+RTYGI C D P L +Y+D G YC
Sbjct: 414 GRAICDGAVNIGFFPKNILCRVARRTYGISMCAEFDSDIHPESLAKYID--GVKYCNHLF 471

Query: 175 DVFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDI 354
FV G V++D S ++ + PT Q + IE+ ++ S P Y D V E F VDI
Sbjct: 472 STFVKAGSTVEMDFSQEKYFWPTSKNQTAISIEVVTTQSPSPTYTTDPGVTVEEEFSVDI 531

Query: 355 SEGMELDK-DRQVEVTMAFGASLIEVSADCLNF 450
S + + K DR++ V+M FG S IEV A +F
Sbjct: 532 SSSLYMAKDDRKILVSMFFGGSCIEVKAQPSHF 564


>tr|A9SRN5|A9SRN5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_233874 PE=4 SV=1
Length = 592

Score = 89.4 bits (220), Expect = 1e-16
Identities = 55/154 (35%), Positives = 81/154 (52%), Gaps = 3/154 (1%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLRVDDPFDLRYVDDDG-DFYCQDCID 177
GSA+C GAV L + I SRIA++TYG R + DP D +Y+ G + C
Sbjct: 421 GSAVCQGAVMLALNPAGITSRIARKTYGFEVSRSFKPGDPEDSKYISWVGAEKKCDVNFS 480

Query: 178 VFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYAR--DVDVIKEGSFVVD 351
+V G+ + +D V + + P G + M++ L+SS PKY + VD +E SF +D
Sbjct: 481 AYVRKGDPLDVDHCVSKDFSPLFPGARNMKLMLYSSNETDPKYTQGPGVDSKEEASFTID 540

Query: 352 ISEGMELDKDRQVEVTMAFGASLIEVSADCLNFG 453
I+ + + V V+M FG S I+V A NFG
Sbjct: 541 ITSSSHMQERPTVTVSMFFGRSAIDVKAVGKNFG 574


>tr|A9SZI2|A9SZI2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_167293 PE=4 SV=1
Length = 844

Score = 88.6 bits (218), Expect = 2e-16
Identities = 52/144 (36%), Positives = 77/144 (53%), Gaps = 1/144 (0%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLRVD-DPFDLRYVDDDGDFYCQDCID 177
GSAI GAV L + ++++RI KRTYG + L DP L V DG +C+ D
Sbjct: 656 GSAIVKGAVALALNPGVVVARILKRTYGTSLTKRLEPGVDPRHLLKVAIDGSQWCRKRFD 715

Query: 178 VFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDIS 357
+F G R++++ VK+ Y P GQ ++ +L SS + P+Y D V+ EG F VD+
Sbjct: 716 IFAKKGTRMEINNCVKKEYAPYKSGQSHIKFDLHSSGDEEPRYTDDPGVVSEGEFTVDLP 775

Query: 358 EGMELDKDRQVEVTMAFGASLIEV 429
+ D E ++ FG S IE+
Sbjct: 776 KNPTHDNVPVYEFSLYFGRSSIEL 799


>tr|A9RPI8|A9RPI8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_160266 PE=4 SV=1
Length = 801

Score = 88.6 bits (218), Expect = 2e-16
Identities = 52/151 (34%), Positives = 87/151 (57%), Gaps = 2/151 (1%)
Frame = +1

Query: 4 SAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLR--VDDPFDLRYVDDDGDFYCQDCID 177
SAI GAV + D I+SR++K+TYG+ + VD L+ +++ C++
Sbjct: 634 SAISLGAVMSALNPDTIISRVSKKTYGVECVEEFKYGVDREDHLQVINNLRR--CRNRFH 691

Query: 178 VFVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDIS 357
++V G+ V +D + + Y P GQ M++ L+SS + +P+Y + V EGSF +DIS
Sbjct: 692 IYVRKGDVVNVDQCISKTYYPARSGQTTMDVTLFSSENTNPRYTDEPGVKMEGSFTIDIS 751

Query: 358 EGMELDKDRQVEVTMAFGASLIEVSADCLNF 450
M LD+ R V+ ++ FG S +E+ A+ +NF
Sbjct: 752 GDMTLDEKRIVKESLYFGRSSLELVAEPVNF 782


>tr|A9SZV1|A9SZV1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_167333 PE=4 SV=1
Length = 628

Score = 82.4 bits (202), Expect = 2e-14
Identities = 49/145 (33%), Positives = 80/145 (55%)
Frame = +1

Query: 1 GSAICHGAVQLHVKKDIILSRIAKRTYGILYCRGLRVDDPFDLRYVDDDGDFYCQDCIDV 180
GSAI GAV L K ++I+ R+ ++TYG D D + + DG YC+ D
Sbjct: 467 GSAIIQGAVLLARKPEVIVERVLRKTYGTSVSLPFEPGDREDFK-IFKDGKKYCRR-FDK 524

Query: 181 FVTTGERVQLDLSVKRIYIPTVHGQQVMEIELWSSTSKHPKYARDVDVIKEGSFVVDISE 360
FVT G+R+++ V + Y+P Q + +L+S+ K+P+Y +D V KEG FVV + +
Sbjct: 525 FVTKGDRIKVSHVVTKEYVPLSSDQDKILFDLYSTDQKNPRYVQDTTVTKEGQFVVTLPK 584

Query: 361 GMELDKDRQVEVTMAFGASLIEVSA 435
++ + + ++ FG S IE+ A
Sbjct: 585 -FNMNNKPKFDFSLYFGGSNIELRA 608