BP915169
Clone id YMU001_000067_D01
Library
Length 563
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_D01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTCATGTCTTTTGAAGCTAGCTCAAGGGACTCCTTCAATTCACTTATCTTTCTATCTCT
GTCCTTCAAGTCCTTTGAACTTGCCTCTAGCCCTTTTTTCAAACTCAAAATCTCCTGAGT
AAGACTTTCTTTACTCTTCACAAGGAATTCTTTCTCATGCACAAGTTCTTCCTTGTCCTT
TACCAAAAGCTCGTTGTCCTCTTGCAAAATCATCTTTTCCTGAATTGCTTCAGGGGAAGC
CGCTAGAAGTAAATGGTAACAGTGCCGTAATGCATCAGGGATATACATGGGTCCAGTTTG
TGGTGCATCAAGGTCTTGATCAACCTCCTCATAAAACGTCATGGCGGTAAGCTTGTACCC
AGCTGCAAGAAGATACTCCTTGACTGCTCAGTTTAGAGCCATTCGTTCACTTTCACGGAG
TGGATCCCAAACAAGGACTTTATTCTTAGTCTCTGTTGCCAGCTCTTGCTTGTCCAAGTC
AGCTGTCAACTTCATCTGCCCCCCTTCAGAGTAAGGCGTTACAAGCATGTCTACTTGTGT
CTCTAGCTTTTGCTGGAGTCTTT
■■Homology search results ■■ -
sp_hit_id Q6P6Y1
Definition sp|Q6P6Y1|K1468_DANRE LisH domain and HEAT repeat-containing protein KIAA1468 homolog OS=Danio rerio
Align length 147
Score (bit) 45.1
E-value 0.0002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915169|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_D01.
(563 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6P6Y1|K1468_DANRE LisH domain and HEAT repeat-containing pro... 45 2e-04
sp|P62135|RAD50_NANEQ DNA double-strand break repair rad50 ATPas... 41 0.005
sp|Q97N21|SYS2_CLOAB Seryl-tRNA synthetase 2 OS=Clostridium acet... 40 0.006
sp|P40957|MAD1_YEAST Spindle assembly checkpoint component MAD1 ... 39 0.014
sp|Q8NEZ2|VP37A_HUMAN Vacuolar protein sorting-associated protei... 39 0.018
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 38 0.030
sp|Q148V7|K1468_MOUSE LisH domain and HEAT repeat-containing pro... 38 0.030
sp|Q9P260|K1468_HUMAN LisH domain and HEAT repeat-containing pro... 38 0.030
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains ... 37 0.051
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains ... 37 0.051
sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 37 0.051
sp|Q08BT5|K1468_XENTR LisH domain and HEAT repeat-containing pro... 37 0.051
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=... 37 0.067
sp|P11137|MAP2_HUMAN Microtubule-associated protein 2 OS=Homo sa... 37 0.067
sp|Q97FK1|SBCC_CLOAB Nuclease sbcCD subunit C OS=Clostridium ace... 37 0.088
sp|Q869E1|DNLI1_DICDI DNA ligase 1 OS=Dictyostelium discoideum G... 37 0.088
sp|Q9Y487|VPP2_HUMAN V-type proton ATPase 116 kDa subunit a isof... 36 0.15
sp|Q8CHS8|VP37A_MOUSE Vacuolar protein sorting-associated protei... 36 0.15
sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=... 36 0.15
sp|Q9QXS1|PLEC1_MOUSE Plectin-1 OS=Mus musculus GN=Plec1 PE=1 SV=2 36 0.15
sp|Q9JI55|PLEC1_CRIGR Plectin-1 (Fragment) OS=Cricetulus griseus... 36 0.15
sp|Q9PTD7|CING_XENLA Cingulin OS=Xenopus laevis GN=cgn PE=1 SV=2 36 0.15
sp|P47166|SGM1_YEAST Protein SGM1 OS=Saccharomyces cerevisiae GN... 35 0.20
sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere-associated ... 35 0.20
sp|P30427|PLEC1_RAT Plectin-1 OS=Rattus norvegicus GN=Plec1 PE=1... 35 0.20
sp|Q3UIJ9|GRL1A_MOUSE Protein GRINL1A OS=Mus musculus GN=Grinl1a... 35 0.20
sp|O96133|YB145_PLAF7 Uncharacterized protein PFB0145c OS=Plasmo... 35 0.25
sp|O97681|VPP2_BOVIN V-type proton ATPase 116 kDa subunit a isof... 35 0.25
sp|Q6P132|TAXB1_DANRE Tax1-binding protein 1 homolog OS=Danio re... 35 0.25
sp|Q22472|RIC3_CAEEL Resistance to inhibitors of cholinesterase ... 35 0.25

>sp|Q6P6Y1|K1468_DANRE LisH domain and HEAT repeat-containing
protein KIAA1468 homolog OS=Danio rerio GN=zgc:66014
PE=2 SV=1
Length = 1189

Score = 45.1 bits (105), Expect = 2e-04
Identities = 39/147 (26%), Positives = 69/147 (46%), Gaps = 27/147 (18%)
Frame = -3

Query: 426 DPLRESERMALN*AVKEYLLAAGYKLTAMTFYEE-VDQDLDAPQTGPMYIP------DAL 268
+P+R E+ ALN V EYLL YKLT++TF +E DQD + + IP
Sbjct: 223 EPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLY 282

Query: 267 RHC----------YHLLLAASP----------EAIQEKMILQEDNELLVKDKEELVHEKE 148
R+C + ++ P E +Q+ ++Q+ + V +EL ++
Sbjct: 283 RNCGNSQPLHRDTVDVAVSVDPSDLPADYFTQEPVQQTDVIQQQQQQEV--VQELEYQIS 340

Query: 147 FLVKSKESLTQEILSLKKGLEASSKDL 67
L K+SL ++I L+ ++A +++
Sbjct: 341 LLNSEKQSLAEQIKKLQSDIQALQRNV 367


>sp|P62135|RAD50_NANEQ DNA double-strand break repair rad50 ATPase
OS=Nanoarchaeum equitans GN=rad50 PE=3 SV=1
Length = 786

Score = 40.8 bits (94), Expect = 0.005
Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
Frame = -3

Query: 222 QEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLK------KGLEASSKDLKD 61
+EK + E ++L K+KE+ E +L+K KESL +EI L+ K LE ++L +
Sbjct: 330 EEKRLEYEKAKMLEKEKEKAKREYSYLLKEKESLEKEIAELQNKINQIKELEKMEQELLE 389

Query: 60 RDRKISELKESLEL 19
+I +K L+L
Sbjct: 390 IQERIGVIKAKLKL 403


>sp|Q97N21|SYS2_CLOAB Seryl-tRNA synthetase 2 OS=Clostridium
acetobutylicum GN=serS2 PE=3 SV=1
Length = 425

Score = 40.4 bits (93), Expect = 0.006
Identities = 30/86 (34%), Positives = 48/86 (55%), Gaps = 10/86 (11%)
Frame = -3

Query: 249 LLAASPEAIQEKMILQEDN----ELLVKDKE--ELVHEKEFLVKSKESLTQEILSLK--- 97
L+ E +++ ++ + DN ELL D E +L+HE E L K +++I ++K
Sbjct: 6 LIRNDTEKVKKALLKKIDNVDFTELLKLDDERRKLIHEVEVLKNKKNEASKQISNIKSQG 65

Query: 96 -KGLEASSKDLKDRDRKISELKESLE 22
K E+ KD+K+ KISEL+ SLE
Sbjct: 66 GKVDESFFKDIKEISNKISELETSLE 91


>sp|P40957|MAD1_YEAST Spindle assembly checkpoint component MAD1
OS=Saccharomyces cerevisiae GN=MAD1 PE=1 SV=1
Length = 749

Score = 39.3 bits (90), Expect = 0.014
Identities = 25/79 (31%), Positives = 47/79 (59%), Gaps = 7/79 (8%)
Frame = -3

Query: 219 EKMILQEDNELLVK-------DKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDLKD 61
EK+ LQ+ +L K + E+ +++ ++L +S + L QE+ SLK E S+ + D
Sbjct: 81 EKLQLQKQTNILEKKYKATIDELEKALNDTKYLYESNDKLEQELKSLK---ERSANSMND 137

Query: 60 RDRKISELKESLELASKDM 4
+D+ I EL+ +L+ +KD+
Sbjct: 138 KDKCIEELRTTLQ--NKDL 154


>sp|Q8NEZ2|VP37A_HUMAN Vacuolar protein sorting-associated protein
37A OS=Homo sapiens GN=VPS37A PE=1 SV=1
Length = 397

Score = 38.9 bits (89), Expect = 0.018
Identities = 27/105 (25%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
Frame = -3

Query: 324 VDQDLDAPQTGPMY----IPDALRHCYHLLLAASPEAIQEKMILQEDNELLVKDKEELVH 157
VD + Q G Y +PDA L ++ + +++ +L E L + ++++
Sbjct: 209 VDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQF-LTLPQLKQIIT 267

Query: 156 EKEFLVKSKESLTQEILSLKKGLEASSKDLKDRDRKISELKESLE 22
+K+ LVKS E L ++ L L+ LEA + + D+ ++++K + E
Sbjct: 268 DKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTFE 312


>sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2
Length = 980

Score = 38.1 bits (87), Expect = 0.030
Identities = 20/68 (29%), Positives = 43/68 (63%)
Frame = -3

Query: 204 QEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDLKDRDRKISELKESL 25
+E+ + L+K KE+ V+E L++ + +E+ +K+ E+SSK +D+D+KI+E+ + +
Sbjct: 835 KENIQTLLKSKEQEVNE---LLQKFQQAQEELAEMKRYAESSSKLEEDKDKKINEMSKEV 891

Query: 24 ELASKDMN 1
+ +N
Sbjct: 892 TKLKEALN 899


>sp|Q148V7|K1468_MOUSE LisH domain and HEAT repeat-containing
protein KIAA1468 OS=Mus musculus GN=Kiaa1468 PE=1 SV=1
Length = 1216

Score = 38.1 bits (87), Expect = 0.030
Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
Frame = -3

Query: 447 KNKVLVWDPLRESERMALN*AVKEYLLAAGYKLTAMTFYEE-VDQDLD 307
K+ + +P++ E+ ALN V E+LL YKLT++TF +E DQD +
Sbjct: 242 KSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFE 289


>sp|Q9P260|K1468_HUMAN LisH domain and HEAT repeat-containing
protein KIAA1468 OS=Homo sapiens GN=KIAA1468 PE=1 SV=2
Length = 1216

Score = 38.1 bits (87), Expect = 0.030
Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
Frame = -3

Query: 447 KNKVLVWDPLRESERMALN*AVKEYLLAAGYKLTAMTFYEE-VDQDLD 307
K+ + +P++ E+ ALN V E+LL YKLT++TF +E DQD +
Sbjct: 242 KSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFE 289


>sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and
ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2
Length = 1416

Score = 37.4 bits (85), Expect = 0.051
Identities = 23/86 (26%), Positives = 48/86 (55%), Gaps = 9/86 (10%)
Frame = -3

Query: 231 EAIQEKMILQEDNELLVKDKEELVH---------EKEFLVKSKESLTQEILSLKKGLEAS 79
E + E+++ + E+ KD++EL+H +KE KS ++T+ L++ ++ S
Sbjct: 1255 EEVCEEVLHAKKKEISAKDEKELLHFSIEQEIKDQKERCDKSLTTITE----LQRRIQES 1310

Query: 78 SKDLKDRDRKISELKESLELASKDMN 1
+K ++ +D KI+EL +E + +N
Sbjct: 1311 AKQIEAKDNKITELLNDVERLKQALN 1336


>sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and
ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1
Length = 1401

Score = 37.4 bits (85), Expect = 0.051
Identities = 24/83 (28%), Positives = 47/83 (56%), Gaps = 6/83 (7%)
Frame = -3

Query: 231 EAIQEKMILQEDNELLVKDKEELVH------EKEFLVKSKESLTQEILSLKKGLEASSKD 70
E + E+++ + EL KD++EL+H K+ + +SLT I L++ ++ S+K
Sbjct: 1240 EEVCEEVLHAKKKELSAKDEKELLHFSIEQEIKDQQERCDKSLT-TITELQRRIQESAKQ 1298

Query: 69 LKDRDRKISELKESLELASKDMN 1
++ +D KI+EL +E + +N
Sbjct: 1299 IEAKDNKITELLNDVERLKQALN 1321


tr_hit_id A7PAV4
Definition tr|A7PAV4|A7PAV4_VITVI Chromosome chr14 scaffold_9, whole genome shotgun sequence OS=Vitis vinifera
Align length 188
Score (bit) 144.0
E-value 3.0e-33
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915169|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_D01.
(563 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PAV4|A7PAV4_VITVI Chromosome chr14 scaffold_9, whole genome... 144 3e-33
tr|Q9LF07|Q9LF07_ARATH Putative uncharacterized protein T21H19_1... 135 2e-30
tr|Q8VYW7|Q8VYW7_ARATH AT5g16210/T21H19_130 OS=Arabidopsis thali... 135 2e-30
tr|Q5QMW8|Q5QMW8_ORYSJ cDNA clone:J023064M06, full insert sequen... 135 2e-30
tr|B8A8Z0|B8A8Z0_ORYSI Putative uncharacterized protein OS=Oryza... 135 2e-30
tr|A2ZTR4|A2ZTR4_ORYSJ Putative uncharacterized protein OS=Oryza... 135 2e-30
tr|A9SN32|A9SN32_PHYPA Predicted protein (Fragment) OS=Physcomit... 110 5e-23
tr|A9RWP2|A9RWP2_PHYPA Predicted protein OS=Physcomitrella paten... 106 1e-21
tr|A9RWN5|A9RWN5_PHYPA Predicted protein OS=Physcomitrella paten... 106 1e-21
tr|Q8GLA1|Q8GLA1_STRPY M protein (Fragment) OS=Streptococcus pyo... 45 0.003
tr|B3GA09|B3GA09_STRPY M protein (Fragment) OS=Streptococcus pyo... 45 0.003
tr|A0PFI7|A0PFI7_STRPY M protein (Fragment) OS=Streptococcus pyo... 45 0.004
tr|A2DGN0|A2DGN0_TRIVA Viral A-type inclusion protein, putative ... 45 0.004
tr|Q99PR6|Q99PR6_CAVPO Enterophilin-2S (Fragment) OS=Cavia porce... 44 0.006
tr|A6V288|A6V288_PSEA7 Motility protein FimV OS=Pseudomonas aeru... 44 0.006
tr|Q6LFD6|Q6LFD6_PLAF7 Integral membrane protein OS=Plasmodium f... 44 0.008
tr|Q2YSQ4|Q2YSQ4_STAAB Probable lipoprotein OS=Staphylococcus au... 43 0.010
tr|Q54831|Q54831_STRPY Emm32 protein (Fragment) OS=Streptococcus... 43 0.010
tr|B6NW56|B6NW56_BRAFL Putative uncharacterized protein (Fragmen... 43 0.014
tr|Q4T3M6|Q4T3M6_TETNG Chromosome undetermined SCAF9987, whole g... 42 0.018
tr|Q99PR7|Q99PR7_CAVPO Enterophilin-2L (Fragment) OS=Cavia porce... 42 0.018
tr|A1ZWP2|A1ZWP2_9SPHI Putative uncharacterized protein OS=Micro... 42 0.018
tr|B3RIS5|B3RIS5_TRIAD Putative uncharacterized protein OS=Trich... 42 0.018
tr|Q4RKR8|Q4RKR8_TETNG Chromosome 5 SCAF15026, whole genome shot... 42 0.023
tr|Q6GIW5|Q6GIW5_STAAR Putative lipoprotein OS=Staphylococcus au... 42 0.030
tr|A2EZ87|A2EZ87_TRIVA Viral A-type inclusion protein, putative ... 42 0.030
tr|O85744|O85744_STRPY M protein (Fragment) OS=Streptococcus pyo... 41 0.039
tr|Q5XBA5|Q5XBA5_STRP6 LPXTG anchored putative adhesin OS=Strept... 40 0.067
tr|B4U0M2|B4U0M2_STREM Putative uncharacterized protein OS=Strep... 40 0.067
tr|Q6SZ55|Q6SZ55_STRPY LPXTG anchored putative adhesin (Surface ... 40 0.067

>tr|A7PAV4|A7PAV4_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038273001
PE=4 SV=1
Length = 1154

Score = 144 bits (364), Expect = 3e-33
Identities = 84/188 (44%), Positives = 115/188 (61%), Gaps = 1/188 (0%)
Frame = -3

Query: 561 RLQQKLETQVDMLVTPYSEGGQMKLTADLDKQELATETKNKVLVWDPLRESERMALN*AV 382
+L+ +LE + D L + + D Q + L PL+++ER LN AV
Sbjct: 101 KLKTELEKKADFLPNSSKSNSDVSVDHGQDIQRQKRDASYSDL--GPLKDNERRDLNCAV 158

Query: 381 KEYLLAAGYKLTAMTFYEEV-DQDLDAPQTGPMYIPDALRHCYHLLLAASPEAIQEKMIL 205
KEYLL AGY+LTAMTFYEEV DQ+LD Q P +PDALRH Y+ L+++ EA +EK+ +
Sbjct: 159 KEYLLLAGYRLTAMTFYEEVIDQNLDVWQNTPACVPDALRHYYYQYLSSTAEAAEEKIAM 218

Query: 204 QEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDLKDRDRKISELKESL 25
+NE L+K E L HEKE L+K+K+ +I +L K EA KDLKDR+ + LK+SL
Sbjct: 219 LRENESLLKANENLNHEKECLLKNKDLADGQIKALTKSSEALQKDLKDRENLVQVLKQSL 278

Query: 24 ELASKDMN 1
E KD+N
Sbjct: 279 EHQRKDLN 286


>tr|Q9LF07|Q9LF07_ARATH Putative uncharacterized protein T21H19_130
OS=Arabidopsis thaliana GN=T21H19_130 PE=4 SV=1
Length = 1189

Score = 135 bits (339), Expect = 2e-30
Identities = 69/142 (48%), Positives = 102/142 (71%), Gaps = 1/142 (0%)
Frame = -3

Query: 423 PLRESERMALN*AVKEYLLAAGYKLTAMTFYEEV-DQDLDAPQTGPMYIPDALRHCYHLL 247
PL+ +ER LN AVKEYLL AGY+LTAMTFYEEV DQ+LD Q P ++PDALR+ Y+
Sbjct: 145 PLKNNERQDLNCAVKEYLLLAGYRLTAMTFYEEVTDQNLDVWQDSPAHVPDALRYYYYQY 204

Query: 246 LAASPEAIQEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDL 67
L+++ EA +EK+ + ++NE L K+ E L EK+ L+KSKE+ ++I + K E+ KDL
Sbjct: 205 LSSTSEAAEEKIAMLQENESLKKEIERLSKEKDGLLKSKENFEEQIGAFNKSTESLQKDL 264

Query: 66 KDRDRKISELKESLELASKDMN 1
+DR++++ LK+S E +++N
Sbjct: 265 RDREKQVQSLKQSSEHQRRNLN 286


>tr|Q8VYW7|Q8VYW7_ARATH AT5g16210/T21H19_130 OS=Arabidopsis thaliana
GN=At5g16210 PE=2 SV=1
Length = 1180

Score = 135 bits (339), Expect = 2e-30
Identities = 69/142 (48%), Positives = 102/142 (71%), Gaps = 1/142 (0%)
Frame = -3

Query: 423 PLRESERMALN*AVKEYLLAAGYKLTAMTFYEEV-DQDLDAPQTGPMYIPDALRHCYHLL 247
PL+ +ER LN AVKEYLL AGY+LTAMTFYEEV DQ+LD Q P ++PDALR+ Y+
Sbjct: 145 PLKNNERQDLNCAVKEYLLLAGYRLTAMTFYEEVTDQNLDVWQDSPAHVPDALRYYYYQY 204

Query: 246 LAASPEAIQEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDL 67
L+++ EA +EK+ + ++NE L K+ E L EK+ L+KSKE+ ++I + K E+ KDL
Sbjct: 205 LSSTSEAAEEKIAMLQENESLKKEIERLSKEKDGLLKSKENFEEQIGAFNKSTESLQKDL 264

Query: 66 KDRDRKISELKESLELASKDMN 1
+DR++++ LK+S E +++N
Sbjct: 265 RDREKQVQSLKQSSEHQRRNLN 286


>tr|Q5QMW8|Q5QMW8_ORYSJ cDNA clone:J023064M06, full insert sequence
OS=Oryza sativa subsp. japonica GN=B1075D06.2 PE=2 SV=1
Length = 1183

Score = 135 bits (339), Expect = 2e-30
Identities = 69/148 (46%), Positives = 103/148 (69%), Gaps = 1/148 (0%)
Frame = -3

Query: 441 KVLVWDPLRESERMALN*AVKEYLLAAGYKLTAMTFYEEV-DQDLDAPQTGPMYIPDALR 265
K+ PL+++ER LN AVKEYLL AGY+L AMTF EEV DQDLD +PDALR
Sbjct: 145 KISTLGPLKDNERKDLNCAVKEYLLLAGYRLAAMTFIEEVPDQDLDVWINSSACVPDALR 204

Query: 264 HCYHLLLAASPEAIQEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLE 85
Y+ L+++ EA +EK+ + +NE L+KD E L EK+ L+KS+E +I +L+K LE
Sbjct: 205 RYYYQYLSSTTEAAEEKISILRENETLLKDNESLGAEKDALIKSREVANSQIAALRKSLE 264

Query: 84 ASSKDLKDRDRKISELKESLELASKDMN 1
A+ KD+K++++ + +LK+SL++ K++N
Sbjct: 265 AAHKDIKEKEKTVQDLKQSLDVQRKELN 292


>tr|B8A8Z0|B8A8Z0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_02169 PE=4 SV=1
Length = 1199

Score = 135 bits (339), Expect = 2e-30
Identities = 69/148 (46%), Positives = 103/148 (69%), Gaps = 1/148 (0%)
Frame = -3

Query: 441 KVLVWDPLRESERMALN*AVKEYLLAAGYKLTAMTFYEEV-DQDLDAPQTGPMYIPDALR 265
K+ PL+++ER LN AVKEYLL AGY+L AMTF EEV DQDLD +PDALR
Sbjct: 161 KISTLGPLKDNERKDLNCAVKEYLLLAGYRLAAMTFIEEVPDQDLDVWINSSACVPDALR 220

Query: 264 HCYHLLLAASPEAIQEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLE 85
Y+ L+++ EA +EK+ + +NE L+KD E L EK+ L+KS+E +I +L+K LE
Sbjct: 221 RYYYQYLSSTTEAAEEKISILRENETLLKDNESLGAEKDALIKSREVANSQIAALRKSLE 280

Query: 84 ASSKDLKDRDRKISELKESLELASKDMN 1
A+ KD+K++++ + +LK+SL++ K++N
Sbjct: 281 AAHKDIKEKEKTVQDLKQSLDVQRKELN 308


>tr|A2ZTR4|A2ZTR4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001936 PE=4 SV=1
Length = 1187

Score = 135 bits (339), Expect = 2e-30
Identities = 69/148 (46%), Positives = 103/148 (69%), Gaps = 1/148 (0%)
Frame = -3

Query: 441 KVLVWDPLRESERMALN*AVKEYLLAAGYKLTAMTFYEEV-DQDLDAPQTGPMYIPDALR 265
K+ PL+++ER LN AVKEYLL AGY+L AMTF EEV DQDLD +PDALR
Sbjct: 161 KISTLGPLKDNERKDLNCAVKEYLLLAGYRLAAMTFIEEVPDQDLDVWINSSACVPDALR 220

Query: 264 HCYHLLLAASPEAIQEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLE 85
Y+ L+++ EA +EK+ + +NE L+KD E L EK+ L+KS+E +I +L+K LE
Sbjct: 221 RYYYQYLSSTTEAAEEKISILRENETLLKDNESLGAEKDALIKSREVANSQIAALRKSLE 280

Query: 84 ASSKDLKDRDRKISELKESLELASKDMN 1
A+ KD+K++++ + +LK+SL++ K++N
Sbjct: 281 AAHKDIKEKEKTVQDLKQSLDVQRKELN 308


>tr|A9SN32|A9SN32_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_40179 PE=4 SV=1
Length = 1064

Score = 110 bits (275), Expect = 5e-23
Identities = 69/186 (37%), Positives = 109/186 (58%)
Frame = -3

Query: 558 LQQKLETQVDMLVTPYSEGGQMKLTADLDKQELATETKNKVLVWDPLRESERMALN*AVK 379
L +K TQ D+ +K + D + L+ + N V++ + L E ER+ L+ AVK
Sbjct: 89 LHEKSATQFDV------SADLLKSVVESDMEVLSANSGNAVVL-ELLGEKERLVLDCAVK 141

Query: 378 EYLLAAGYKLTAMTFYEEVDQDLDAPQTGPMYIPDALRHCYHLLLAASPEAIQEKMILQE 199
EYL+ AGYK+ AMTF EEV+ DLD+ ++P+ALR Y LAA+ EA ++
Sbjct: 142 EYLMFAGYKIAAMTFQEEVNIDLDSWPHTAAHVPEALRQYYRAFLAATVEA-------RQ 194

Query: 198 DNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDLKDRDRKISELKESLEL 19
D + + K+++ L+ E E L K KE L E +S+ K E+ + LK++DR + ++KESLE
Sbjct: 195 DKDAVHKERDALLKEIESLSKEKEVLKVENMSMVKSAESLRRALKEKDRHVQQMKESLEQ 254

Query: 18 ASKDMN 1
++ +N
Sbjct: 255 STIQLN 260


>tr|A9RWP2|A9RWP2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_178851 PE=4 SV=1
Length = 1136

Score = 106 bits (264), Expect = 1e-21
Identities = 66/186 (35%), Positives = 101/186 (54%)
Frame = -3

Query: 558 LQQKLETQVDMLVTPYSEGGQMKLTADLDKQELATETKNKVLVWDPLRESERMALN*AVK 379
LQ+KL QV+ V + LT E + + V V L E E++ +N AVK
Sbjct: 95 LQEKLSNQVE--VASDLSRPDVSLTDTATNGEKSMTSNGSVKVLGKLGEKEKLDINCAVK 152

Query: 378 EYLLAAGYKLTAMTFYEEVDQDLDAPQTGPMYIPDALRHCYHLLLAASPEAIQEKMILQE 199
EYL+ AGYK++AMTF EEV+ DLD ++PDALRH YH + ++ EA K
Sbjct: 153 EYLMVAGYKISAMTFQEEVNLDLDDWPDTVAHVPDALRHYYHAFVCSTAEARMHKDAFVS 212

Query: 198 DNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDLKDRDRKISELKESLEL 19
+D+E LV E + L+ E+ +E LSL K +E K ++ +++ ++KES E
Sbjct: 213 LLFSFFQDREALVKENDVLLHQNEAFERENLSLAKTVEQHRKGEREWEKQAQQMKESFEQ 272

Query: 18 ASKDMN 1
+++ +N
Sbjct: 273 STRLLN 278


>tr|A9RWN5|A9RWN5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_120462 PE=4 SV=1
Length = 1037

Score = 106 bits (264), Expect = 1e-21
Identities = 66/186 (35%), Positives = 101/186 (54%)
Frame = -3

Query: 558 LQQKLETQVDMLVTPYSEGGQMKLTADLDKQELATETKNKVLVWDPLRESERMALN*AVK 379
LQ+KL QV+ V + LT E + + V V L E E++ +N AVK
Sbjct: 95 LQEKLSNQVE--VASDLSRPDVSLTDTATNGEKSMTSNGSVKVLGKLGEKEKLDINCAVK 152

Query: 378 EYLLAAGYKLTAMTFYEEVDQDLDAPQTGPMYIPDALRHCYHLLLAASPEAIQEKMILQE 199
EYL+ AGYK++AMTF EEV+ DLD ++PDALRH YH + ++ EA K
Sbjct: 153 EYLMVAGYKISAMTFQEEVNLDLDDWPDTVAHVPDALRHYYHAFVCSTAEARMHKDAFVS 212

Query: 198 DNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDLKDRDRKISELKESLEL 19
+D+E LV E + L+ E+ +E LSL K +E K ++ +++ ++KES E
Sbjct: 213 LLFSFFQDREALVKENDVLLHQNEAFERENLSLAKTVEQHRKGEREWEKQAQQMKESFEQ 272

Query: 18 ASKDMN 1
+++ +N
Sbjct: 273 STRLLN 278


>tr|Q8GLA1|Q8GLA1_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 340

Score = 45.1 bits (105), Expect = 0.003
Identities = 24/65 (36%), Positives = 39/65 (60%)
Frame = -3

Query: 219 EKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKGLEASSKDLKDRDRKISE 40
E L+ +N L +KEEL EKE L + K+ LT+E +GL + +DL ++R++++
Sbjct: 62 ENSDLKTENSKLTSEKEELTQEKEDLTQEKQRLTRE----NRGLTSEKEDLTQKNRELTK 117

Query: 39 LKESL 25
KE L
Sbjct: 118 EKEEL 122



Score = 38.5 bits (88), Expect = 0.25
Identities = 25/85 (29%), Positives = 41/85 (48%)
Frame = -3

Query: 270 LRHCYHLLLAASPEAIQEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEILSLKKG 91
L H L + + E L + E L ++KE+L EK+ L + LT E K+
Sbjct: 52 LEHNNEKLKTENSDLKTENSKLTSEKEELTQEKEDLTQEKQRLTRENRGLTSE----KED 107

Query: 90 LEASSKDLKDRDRKISELKESLELA 16
L +++L ++S+ KE+L LA
Sbjct: 108 LTQKNRELTKEKEELSKQKETLGLA 132



Score = 35.0 bits (79), Expect = 2.8
Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 4/66 (6%)
Frame = -3

Query: 222 QEKMILQEDNELLVKDKEELVHEKEFLVKSKESLTQEI----LSLKKGLEASSKDLKDRD 55
QEK L +N L +KE+L + L K KE L+++ L+L K ++ K D
Sbjct: 89 QEKQRLTRENRGLTSEKEDLTQKNRELTKEKEELSKQKETLGLALDKTIDEKIKSDNDHK 148

Query: 54 RKISEL 37
++I +L
Sbjct: 149 KEIGDL 154