BP915178
Clone id YMU001_000067_D11
Library
Length 265
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_D11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGTTGGGTGTGAAAACATACTTGAAGGAGAGAATGTTAATGATGGACCTCTTCTTGCTG
GCTTTAGACGCAGATGTCATAGAATGCATCCTCCTGGATGACGTCCTGACCAGCGGAGAG
AACATGAAGTCTACCCTGTTGGTTTTCGCAAATTGGTAGAAGACCTCTTCAAAGGTGAGG
AGACGGTAGTGAGAGCCGACATGGAGGGGAGCATCTGTGGCCAAAAGGGAGGGTCGAATG
TGTCTAGAAGTAGTAGGCGCTGTGG
■■Homology search results ■■ -
sp_hit_id Q66NC0
Definition sp|Q66NC0|GDF9_CAPHI Growth/differentiation factor 9 OS=Capra hircus
Align length 27
Score (bit) 30.8
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915178|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_D11.
(265 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q66NC0|GDF9_CAPHI Growth/differentiation factor 9 OS=Capra hi... 31 2.2
sp|P23347|B3A2_RAT Anion exchange protein 2 OS=Rattus norvegicus... 30 3.8
sp|Q9Z0S8|B3A2_CAVPO Anion exchange protein 2 OS=Cavia porcellus... 30 3.8
sp|Q8N910|CO056_HUMAN Putative uncharacterized protein C15orf56 ... 29 6.5
sp|P02730|B3AT_HUMAN Band 3 anion transport protein OS=Homo sapi... 29 6.5
sp|P23562|B3AT_RAT Band 3 anion transport protein OS=Rattus norv... 29 8.5

>sp|Q66NC0|GDF9_CAPHI Growth/differentiation factor 9 OS=Capra
hircus GN=GDF9 PE=3 SV=1
Length = 453

Score = 30.8 bits (68), Expect = 2.2
Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 3/27 (11%)
Frame = +3

Query: 72 RCHRMHP---PG*RPDQRREHEVYPVG 143
R H +HP P PDQRRE YPVG
Sbjct: 278 RWHSLHPKRKPSQGPDQRRELSAYPVG 304


>sp|P23347|B3A2_RAT Anion exchange protein 2 OS=Rattus norvegicus
GN=Slc4a2 PE=2 SV=1
Length = 1234

Score = 30.0 bits (66), Expect = 3.8
Identities = 13/35 (37%), Positives = 21/35 (60%)
Frame = -3

Query: 227 LLATDAPLHVGSHYRLLTFEEVFYQFAKTNRVDFM 123
LL L +G LL FEE F+ F K+N+++++
Sbjct: 753 LLGAQPLLVIGFSGPLLVFEEAFFSFCKSNQLEYL 787


>sp|Q9Z0S8|B3A2_CAVPO Anion exchange protein 2 OS=Cavia porcellus
GN=SLC4A2 PE=2 SV=1
Length = 1238

Score = 30.0 bits (66), Expect = 3.8
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = -3

Query: 227 LLATDAPLHVGSHYRLLTFEEVFYQFAKTNRVDFM 123
LL L +G LL FEE FY F ++N ++++
Sbjct: 753 LLGAQPLLVIGFSGPLLVFEEAFYSFCRSNELEYL 787


>sp|Q8N910|CO056_HUMAN Putative uncharacterized protein C15orf56
OS=Homo sapiens GN=C15orf56 PE=2 SV=1
Length = 161

Score = 29.3 bits (64), Expect = 6.5
Identities = 10/22 (45%), Positives = 16/22 (72%)
Frame = -1

Query: 265 PQRLLLLDTFDPPFWPQMLPSM 200
P+ +LL++F PP WPQ P++
Sbjct: 108 PRGAVLLNSFSPPAWPQFPPAL 129


>sp|P02730|B3AT_HUMAN Band 3 anion transport protein OS=Homo sapiens
GN=SLC4A1 PE=1 SV=3
Length = 911

Score = 29.3 bits (64), Expect = 6.5
Identities = 14/36 (38%), Positives = 21/36 (58%)
Frame = -3

Query: 230 SLLATDAPLHVGSHYRLLTFEEVFYQFAKTNRVDFM 123
+LL L VG LL FEE F+ F +TN ++++
Sbjct: 452 ALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYI 487


>sp|P23562|B3AT_RAT Band 3 anion transport protein OS=Rattus
norvegicus GN=Slc4a1 PE=2 SV=3
Length = 927

Score = 28.9 bits (63), Expect = 8.5
Identities = 13/36 (36%), Positives = 21/36 (58%)
Frame = -3

Query: 230 SLLATDAPLHVGSHYRLLTFEEVFYQFAKTNRVDFM 123
+LL L +G LL FEE FY F ++N ++++
Sbjct: 469 ALLGAQPLLVLGFSGPLLVFEEAFYSFCESNNLEYI 504


tr_hit_id Q4RMY1
Definition tr|Q4RMY1|Q4RMY1_TETNG Chromosome 6 SCAF15017, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis
Align length 35
Score (bit) 33.1
E-value 7.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915178|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_D11.
(265 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4RMY1|Q4RMY1_TETNG Chromosome 6 SCAF15017, whole genome shot... 33 7.1

>tr|Q4RMY1|Q4RMY1_TETNG Chromosome 6 SCAF15017, whole genome shotgun
sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00031825001 PE=4 SV=1
Length = 1284

Score = 33.1 bits (74), Expect = 7.1
Identities = 16/35 (45%), Positives = 20/35 (57%)
Frame = -3

Query: 227 LLATDAPLHVGSHYRLLTFEEVFYQFAKTNRVDFM 123
LL L VG LL FEE FY F KTN ++++
Sbjct: 808 LLGAQPLLIVGFSGPLLVFEEAFYSFCKTNNMEYL 842